DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Listericin and Y39A3B.7

DIOPT Version :9

Sequence 1:NP_610650.1 Gene:Listericin / 36183 FlyBaseID:FBgn0033593 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001254851.1 Gene:Y39A3B.7 / 13188641 WormBaseID:WBGene00206512 Length:124 Species:Caenorhabditis elegans


Alignment Length:140 Identity:52/140 - (37%)
Similarity:70/140 - (50%) Gaps:41/140 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQYLVLALVFAAILAMISG-HPLEEQKITLEDA--------EAQPGIDDGTGVRAARHFG--GG 54
            |:...:::.||.||..:... .|..|:|   :|:        .|..||....|.:..:.:|  ||
 Worm     1 MRSIFIISAVFLAIFVICEAVGPHTEKK---DDSVAVDPNFGHANAGIWKNNGKKREKRYGYYGG 62

  Fly    55 F-GRGGYCCGGGGGFRRGGFG--GGGYGG-GGYG----GGGYPGGGFGGYPRGGFGGGSASASAS 111
            : |.|||..||.||: .||:|  |||||| ||:|    ||||  ||:|||  ||:||        
 Worm    63 YGGYGGYGYGGYGGY-YGGYGGYGGGYGGYGGWGRRRWGGGY--GGYGGY--GGYGG-------- 114

  Fly   112 ASASSSWGRK 121
                  |||:
 Worm   115 ------WGRR 118



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.