DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment metro and MAPKKK7

DIOPT Version :9

Sequence 1:NP_610642.2 Gene:metro / 36176 FlyBaseID:FBgn0050021 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_187962.1 Gene:MAPKKK7 / 820555 AraportID:AT3G13530 Length:1368 Species:Arabidopsis thaliana


Alignment Length:287 Identity:66/287 - (22%)
Similarity:99/287 - (34%) Gaps:94/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PALSKLI---STLKESEN-LSNDQEIDFLKAL---LESKELNALVNVHTKV-------AKVG--R 62
            |.|.|::   :.|....| |.|.|..|.:|.|   ||.|:.:.:..:|.:|       .|:.  |
plant  1087 PILLKILECTNHLSTDPNCLENLQRADAIKHLIPNLELKDGHLVYQIHHEVLSALFNLCKINKRR 1151

  Fly    63 DDRLA-----------------------PVLSTSAQVLYEVLEQLSQHCHLN------DD----- 93
            .::.|                       |:|...|.......|||..|..|:      ||     
plant  1152 QEQAAENGIIPHLMLFIMSDSPLKQYALPLLCDMAHASRNSREQLRAHGGLDVYLSLLDDEYWSV 1216

  Fly    94 --------CKEAFHLLQDS---HLQHLLFAHDAIAQK--DFYPHLPEAPVEMDEDEETIKIVQLV 145
                    |     |.||:   .::..|...||| ||  ||:...||... :...|..:||:  .
plant  1217 IALDSIAVC-----LAQDNDNRKVEQALLKQDAI-QKLVDFFQSCPERHF-VHILEPFLKII--T 1272

  Fly   146 KSNEPLTGAQSTEPIVGATIKTDEESGKIIIARIMHGGAADRSGLIHVGDEVIE----VNNINVE 206
            ||..    ...|..:.|.|        .::|:|:.|..|..|..|:.:...|.|    ...:.||
plant  1273 KSYR----INKTLAVNGLT--------PLLISRLDHQDAIARLNLLKLIKAVYEHHPRPKQLIVE 1325

  Fly   207 GKTPGDVLTIL------QNSEGTITFK 227
            ...|..:..::      |.|.|.:..|
plant  1326 NDLPQKLQNLIEERRDGQRSGGQVLVK 1352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
metroNP_610642.2 L27 17..68 CDD:197794 17/89 (19%)
L27 75..127 CDD:197794 19/75 (25%)
PDZ_signaling 139..229 CDD:238492 22/99 (22%)
SH3_MPP 243..302 CDD:212796
Guanylate_kin 390..575 CDD:279019
GuKc 399..580 CDD:214504
MAPKKK7NP_187962.1 STKc_Cdc7_like 19..274 CDD:270797
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.