DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment metro and GK-1

DIOPT Version :9

Sequence 1:NP_610642.2 Gene:metro / 36176 FlyBaseID:FBgn0050021 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001323630.1 Gene:GK-1 / 818788 AraportID:AT2G41880 Length:416 Species:Arabidopsis thaliana


Alignment Length:284 Identity:75/284 - (26%)
Similarity:122/284 - (42%) Gaps:62/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 PKTKKIMYDLTENDDFDREQ--IATYEEVA-KLYPRPGVFRPIVLIGAPGVGRNELRRRLIARDP 414
            |:...|.: |..:..:.|||  :...|.|| ....|....:|||:.|..|||:..|...|:...|
plant    99 PRNDSIWF-LEVDSPYVREQKKLLRKEVVAWSKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFP 162

  Fly   415 EKFRSPVPYTTRPMRTGEVAGREYIFVAREKMDADIEAGKFVEHGEYKGHLYGTSAESVKSIVNA 479
            ..|...|.:|||..|:.|:.|..|.|..::.|:.:|:.|||:|.....|:|||||.|||:::.::
plant   163 SMFGFSVSHTTRSPRSMEMDGVHYHFADKKVMEKEIKDGKFLEFASVHGNLYGTSIESVEAVTDS 227

  Fly   480 G--------------CV---------------CVLSPHYQAIKTLRTAQLKPFLIHVKPPEL--- 512
            |              ||               |:|....|..:::|.:.|....|.|.||.:   
plant   228 GKVYKKAFGLITDAFCVFDLLNNEFCFCPTQRCILDIDVQGARSVRASSLDAIFIFVCPPSMKEL 292

  Fly   513 -DILKATRTEARAKSTFDEANARSFTDEEFEDMIKSAER--IDFLYGHFFDVELVNGELVNAFEQ 574
             |.|:|..||               |:|:.:..:::||.  .:.:....|.:.|.|..|...:::
plant   293 EDRLRARGTE---------------TEEQIQKRLRNAEAEIKEGISSGIFGLILYNDNLEECYKK 342

  Fly   575 L--------VQNVQRLENEPVWAP 590
            |        :.:|..:|.|.:..|
plant   343 LKNLLGLDGLAHVNGVEIEGINLP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
metroNP_610642.2 L27 17..68 CDD:197794
L27 75..127 CDD:197794
PDZ_signaling 139..229 CDD:238492
SH3_MPP 243..302 CDD:212796
Guanylate_kin 390..575 CDD:279019 60/219 (27%)
GuKc 399..580 CDD:214504 57/223 (26%)
GK-1NP_001323630.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.