Sequence 1: | NP_610642.2 | Gene: | metro / 36176 | FlyBaseID: | FBgn0050021 | Length: | 595 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001323630.1 | Gene: | GK-1 / 818788 | AraportID: | AT2G41880 | Length: | 416 | Species: | Arabidopsis thaliana |
Alignment Length: | 284 | Identity: | 75/284 - (26%) |
---|---|---|---|
Similarity: | 122/284 - (42%) | Gaps: | 62/284 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 353 PKTKKIMYDLTENDDFDREQ--IATYEEVA-KLYPRPGVFRPIVLIGAPGVGRNELRRRLIARDP 414
Fly 415 EKFRSPVPYTTRPMRTGEVAGREYIFVAREKMDADIEAGKFVEHGEYKGHLYGTSAESVKSIVNA 479
Fly 480 G--------------CV---------------CVLSPHYQAIKTLRTAQLKPFLIHVKPPEL--- 512
Fly 513 -DILKATRTEARAKSTFDEANARSFTDEEFEDMIKSAER--IDFLYGHFFDVELVNGELVNAFEQ 574
Fly 575 L--------VQNVQRLENEPVWAP 590 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
metro | NP_610642.2 | L27 | 17..68 | CDD:197794 | |
L27 | 75..127 | CDD:197794 | |||
PDZ_signaling | 139..229 | CDD:238492 | |||
SH3_MPP | 243..302 | CDD:212796 | |||
Guanylate_kin | 390..575 | CDD:279019 | 60/219 (27%) | ||
GuKc | 399..580 | CDD:214504 | 57/223 (26%) | ||
GK-1 | NP_001323630.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |