DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment metro and Pdzd2

DIOPT Version :9

Sequence 1:NP_610642.2 Gene:metro / 36176 FlyBaseID:FBgn0050021 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001074533.1 Gene:Pdzd2 / 68070 MGIID:1922394 Length:2796 Species:Mus musculus


Alignment Length:278 Identity:63/278 - (22%)
Similarity:103/278 - (37%) Gaps:94/278 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LEAVMASDINWDPALSKLISTLKESENLSNDQEIDFLKALLESKELNAL--------------VN 52
            |:||::...:..|.|..:.....:||   |.::|.|:  :|..||.:.|              |.
Mouse  2548 LQAVLSLVGSKSPILPLIQEAKAQSE---NKEDICFI--VLNKKEGSGLGFSVAGGADVEPESVL 2607

  Fly    53 VH--------TKVAKVGRDDRLAPVLSTSAQVL-----YEVLEQLSQHCHL-------NDDCKEA 97
            ||        ::...|.:.|.|..|..||...|     .:||.|...|.|:       ||..:.:
Mouse  2608 VHRVFSQGVASQEGTVSQGDFLLSVNGTSLAGLSHSEVTKVLHQAELHKHVLMIIKKGNDQPRPS 2672

  Fly    98 FHLLQDSHLQHLLF----------------AHDAIAQKDFYPHLPEAPVEMDEDEETIKIVQLVK 146
            |.....|......|                ||||:.                        |:::|
Mouse  2673 FRQEPPSANGKAPFPRRTLPLEPGAGRNGAAHDALC------------------------VEVLK 2713

  Fly   147 SNE----PLTGAQSTEPIVGATIKTDEESGKIIIARIMHGGAADRSGLIHVGDEVIEVNNINVEG 207
            ::.    .|.|.:|:  |.|        .|.::|.|:..||||:::|.|..|||::.:|...:.|
Mouse  2714 TSAGLGLSLDGGKSS--IAG--------DGPLVIKRVYQGGAAEQAGTIEAGDEILAINGKPLVG 2768

  Fly   208 KTPGDVLTILQN-SEGTI 224
            ....|...|::: .||.:
Mouse  2769 LVHFDAWNIMKSVPEGPV 2786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
metroNP_610642.2 L27 17..68 CDD:197794 15/72 (21%)
L27 75..127 CDD:197794 15/79 (19%)
PDZ_signaling 139..229 CDD:238492 25/91 (27%)
SH3_MPP 243..302 CDD:212796
Guanylate_kin 390..575 CDD:279019
GuKc 399..580 CDD:214504
Pdzd2NP_001074533.1 PDZ_signaling 335..416 CDD:238492
PDZ_signaling 591..672 CDD:238492
PDZ_signaling 729..813 CDD:238492
PHA03307 1050..>1355 CDD:223039
PHA03247 <1197..1562 CDD:223021
PDZ_signaling 2581..2663 CDD:238492 19/83 (23%)
PDZ 2709..2791 CDD:214570 25/88 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.