DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment metro and SPBC1198.05

DIOPT Version :9

Sequence 1:NP_610642.2 Gene:metro / 36176 FlyBaseID:FBgn0050021 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_595074.1 Gene:SPBC1198.05 / 2539674 PomBaseID:SPBC1198.05 Length:202 Species:Schizosaccharomyces pombe


Alignment Length:192 Identity:50/192 - (26%)
Similarity:88/192 - (45%) Gaps:21/192 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 RPIVLIGAPGVGRNELRRRLIARDPEKFRSPVPYTTRPMRTGEVAGREYIFVAREKMDADIEAGK 454
            :|:|:.|..|||::.|.:||:....:|....|.:|||..|.||..|.:|.||.:|:....:...|
pombe    19 KPVVVFGPSGVGKSTLLKRLLKDHGDKLGFSVSHTTRTPRAGEKDGIDYHFVTKEEFQKLVAEEK 83

  Fly   455 FVEHGEYKGHLYGTSAESVKSIVNAGCVCVLSPHYQAIKTLRTAQLKPFLIHVKPPELDIL---- 515
            |||...:.|::||||..:::.:.......:|....|.:..::.:.:....:.:.||.::.|    
pombe    84 FVEWAVFSGNMYGTSIMAIQELEAVNKKAILDIDLQGVLQVKASPIDAQYVFLAPPSIEQLEVRL 148

  Fly   516 --KATRTEARAKSTFDEANARSFTDEEFEDMIKSAERIDFLYGHFFDVELVNGELVNAFEQL 575
              :.|..|:......:.|.|      |.|...|...         ||..:||.::..|::||
pombe   149 RGRGTENESAILQRLERARA------EIEYSEKPGN---------FDALIVNDDVEKAYKQL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
metroNP_610642.2 L27 17..68 CDD:197794
L27 75..127 CDD:197794
PDZ_signaling 139..229 CDD:238492
SH3_MPP 243..302 CDD:212796
Guanylate_kin 390..575 CDD:279019 48/190 (25%)
GuKc 399..580 CDD:214504 47/183 (26%)
SPBC1198.05NP_595074.1 Gmk 17..201 CDD:223272 50/192 (26%)
guanyl_kin 19..201 CDD:213788 50/192 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.