DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment metro and mpp7b

DIOPT Version :9

Sequence 1:NP_610642.2 Gene:metro / 36176 FlyBaseID:FBgn0050021 Length:595 Species:Drosophila melanogaster
Sequence 2:XP_021324128.1 Gene:mpp7b / 101882129 ZFINID:ZDB-GENE-141212-293 Length:298 Species:Danio rerio


Alignment Length:267 Identity:131/267 - (49%)
Similarity:174/267 - (65%) Gaps:16/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VHTKVAKVGRDDRLAPVLSTSAQVLYEVLEQLSQHCHLNDDCKEAFHLLQDSHLQHLLFAHDAIA 117
            |:.::.|. |..|.||:|.::..:.:.:.|:|....: :.:..|..:||...|:|.||..||.:|
Zfish    10 VYDRLQKY-RAQRPAPLLDSTQGLAHRLAEELQDTVN-SPETTELLNLLSKPHVQTLLLVHDVVA 72

  Fly   118 QKDFYPHLPEAPVEMD---EDEETIKIVQLVKSNEPLTGAQSTEPIVGATIKTDEESGKIIIARI 179
            ||.|.|.||..|...|   |||::||||.|||:.|||          |||||.||.||.||:||:
Zfish    73 QKRFDPRLPPLPPLPDCNEEDEDSIKIVCLVKNQEPL----------GATIKRDESSGAIIVARV 127

  Fly   180 MHGGAADRSGLIHVGDEVIEVNNINVEGKTPGDVLTILQNSEGTITFKLVPADNKGAQ-RESKVR 243
            |.|||||||||||.||.:.|||.:.||.|...:::.||..|||.:|||:||..|:..: .:::|.
Zfish   128 MRGGAADRSGLIHEGDMLKEVNGVPVEDKNLQEIIPILAKSEGAVTFKVVPGTNEELETNDTQVF 192

  Fly   244 VRAHFDYNPDVDPYIPCKEAGLAFQRGDVLHIVAQDDAYWWQARKEHERSARAGLIPSRALQERR 308
            |||.|||:|..||.|||::|||.|||||||.||:|||..|||||:..:.:.||||||||.|||||
Zfish   193 VRALFDYDPQADPAIPCRDAGLEFQRGDVLQIVSQDDDTWWQARRHGDANLRAGLIPSRQLQERR 257

  Fly   309 ILHDRTQ 315
            ::..|.:
Zfish   258 VMLQRPE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
metroNP_610642.2 L27 17..68 CDD:197794 4/14 (29%)
L27 75..127 CDD:197794 17/51 (33%)
PDZ_signaling 139..229 CDD:238492 51/89 (57%)
SH3_MPP 243..302 CDD:212796 38/58 (66%)
Guanylate_kin 390..575 CDD:279019
GuKc 399..580 CDD:214504
mpp7bXP_021324128.1 L27 31..74 CDD:308467 12/43 (28%)
PDZ 97..179 CDD:214570 52/91 (57%)
SH3_MPP 192..252 CDD:212796 39/59 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7412
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245552at33208
OrthoFinder 1 1.000 - - FOG0000824
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.