DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7737 and paox

DIOPT Version :9

Sequence 1:NP_001286308.1 Gene:CG7737 / 36174 FlyBaseID:FBgn0033584 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001011373.1 Gene:paox / 496840 XenbaseID:XB-GENE-946701 Length:301 Species:Xenopus tropicalis


Alignment Length:288 Identity:82/288 - (28%)
Similarity:141/288 - (48%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IVVIGAGASGVACATKLLELGFQNVLVVEAEDRLGGRIHTIPFADNVIDLGAQWCHG-ERDNIVY 109
            :::||||.||:|.|.||.|.||:|..::||..|.||||.:..:|..::::||||.|| ...|.|:
 Frog     8 VLIIGAGISGLAAAQKLHERGFRNFRILEATGRSGGRIRSRKYAKGLVEIGAQWIHGPSPSNPVF 72

  Fly   110 ELTRKQDEELLESTGPVYENYECVRSNG----DVVPEEVSSRLKAIVGDSLV---------TRQL 161
            :|:.:.:  ||.|.....|| :.|...|    .|:......::...||:::|         :|:.
 Frog    73 QLSTQYN--LLSSEALSEEN-QLVELEGHPMFSVIYSSSGKQINRGVGENVVEMFSSWLQKSREF 134

  Fly   162 ELRHCS--GSLGSYLTNKFYDTLRRPENSDIDAEVA--SEFFVNYQKFENSVEASDTLEQVSGRG 222
            ....|:  .|:||:|..:..::....|...::.::|  |..|    |.|..:..:.:::.|:...
 Frog   135 TKGGCNPEESVGSFLRQEICNSYSNWERDSLELKMALLSGLF----KLECCISGTHSMDYVALSS 195

  Fly   223 YLDYWECEG-DILLNWKDKGYVELLRLLMRSRELNVEHGVLEQRLLLGTRVVKINW----NRNDG 282
            ..:|....| |...   .:||..|:.        :::.......:||...|..|||    :.:|.
 Frog   196 CGEYEMLPGLDCTF---PRGYESLVD--------HIKASFPSDNVLLNKPVKTINWKGSFSGSDS 249

  Fly   283 R---VELQMSNGETCIADHVVVTVSLGV 307
            |   |:::..||||.:||||::||.||:
 Frog   250 RIYPVQVECENGETFVADHVILTVPLGI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7737NP_001286308.1 NAD_binding_8 48..106 CDD:290186 28/58 (48%)
Amino_oxidase 54..526 CDD:279874 78/280 (28%)
paoxNP_001011373.1 Amino_oxidase 6..>277 CDD:332356 81/286 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375579at33208
OrthoFinder 1 1.000 - - FOG0000632
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X429
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.