DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7737 and Ppox

DIOPT Version :9

Sequence 1:NP_001286308.1 Gene:CG7737 / 36174 FlyBaseID:FBgn0033584 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_651278.2 Gene:Ppox / 42939 FlyBaseID:FBgn0020018 Length:475 Species:Drosophila melanogaster


Alignment Length:374 Identity:74/374 - (19%)
Similarity:133/374 - (35%) Gaps:99/374 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VIGAGASGVACATKLLELGFQNVLVVEAEDRLGGRIHTIPFADN--VIDLGAQWCH--GERDNIV 108
            |:|.|.||::....||....:.:.:.||..|:||.:.:....|.  :.:.|.:...  ||.....
  Fly     5 VLGGGLSGLSAGYYLLRRFGKPLTIYEASPRVGGWVRSENRKDRNFIFESGPRTIRPVGEPGANT 69

  Fly   109 YELTRKQDEELLESTGPVYENYE-------------CVRSNG-----DVVPEEVSSRLKAIVGDS 155
            .||.    |:|.....|:..::.             |:..|.     .|:|.......||::.| 
  Fly    70 LELV----EDLKLEVTPIRRSHVAARNRMLYAKGQLCMLPNSPKGLFGVLPPFTKPLYKAVLRD- 129

  Fly   156 LVTRQLELRHCSGSLGSYLTNKF----YDTLRRPENSDIDAEVASEFFVNY-------------- 202
            |.|...:.:....|:.|:...:|    .|....|....|.|..|.|..|.:              
  Fly   130 LFTASKKAKLEDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVRFLMEGLFEKEQKYGG 194

  Fly   203 -------QKFENSVEASDTLE--------QVSGRGYLDYWECEGDILLNWKDKGYVELLRLLMR- 251
                   .:||.: :..||.:        ::..:...:.|...|       .||.:|.|...|| 
  Fly   195 VLKGTLISRFEKN-KTKDTKDGLFAERQPKLYAQAVKEKWAMYG-------LKGGLENLPKTMRK 251

  Fly   252 ---SRELNVEHGVLEQRLLLGTRVVKINWNRNDGRVELQMSNGETCIADHVVVTVS----LGVLK 309
               .|::||:.....:.|...:..|::|           :.:.|..: :|||.::.    ..::|
  Fly   252 YLGERDVNVQLSNECRNLTFSSSGVRMN-----------IKDAEVPV-EHVVSSLPAYKLAPLVK 304

  Fly   310 DQHLRLFEPQLPVEKQRAIDGLAFGTVNKIFVEFPEAFWPEDWTGFTML 358
            .||     |.|..:    :..:.:..|..:.::||.....:|  ||.:|
  Fly   305 QQH-----PSLSAQ----LLSIPYVDVLVVNMQFPGKLLKQD--GFGLL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7737NP_001286308.1 NAD_binding_8 48..106 CDD:290186 16/61 (26%)
Amino_oxidase 54..526 CDD:279874 71/368 (19%)
PpoxNP_651278.2 HemY 17..472 CDD:224153 69/362 (19%)
NAD_binding_8 18..76 CDD:290186 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.