DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7737 and IL4I1

DIOPT Version :9

Sequence 1:NP_001286308.1 Gene:CG7737 / 36174 FlyBaseID:FBgn0033584 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001244946.1 Gene:IL4I1 / 259307 HGNCID:19094 Length:589 Species:Homo sapiens


Alignment Length:553 Identity:134/553 - (24%)
Similarity:207/553 - (37%) Gaps:155/553 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RKIVVIGAGASGVACATKLLELGFQNVLVVEAEDRLGGRIHTIPFADN----VIDLGA------- 97
            ::::|:|||.:|:..|..|.:.| ..|.::||::|:||||.|  :.|.    :.:|||       
Human    82 QRVIVVGAGVAGLVAAKVLSDAG-HKVTILEADNRIGGRIFT--YRDQNTGWIGELGAMRMPSSH 143

  Fly    98 ----QWCHGERDNI-------------VYELTRKQ--DEELLESTGPVYENYECVRSNGDVVPEE 143
                :.|.|...|:             |:|:..:.  .|::.|..|......|...|..|:....
Human   144 RILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRNYVVEKVPEKLGYALRPQEKGHSPEDIYQMA 208

  Fly   144 VSSRLKAI--VGDSLVTRQLELRHCSGSLGSYLTNKFYDTLRRPENSDIDAEVASE--FFVNYQK 204
            ::..||.:  :|.....::.| ||   :|..||..:  ..|.||. ..:..:|.||  ||  |..
Human   209 LNQALKDLKALGCRKAMKKFE-RH---TLLEYLLGE--GNLSRPA-VQLLGDVMSEDGFF--YLS 264

  Fly   205 FENSVEASDTLEQVSGRGYLDYWECEGDILLNWKDKGYVELLRLLMRSRELNVEHGVLEQRLLLG 269
            |..::.|...|   |.|  |.|....|         |:..|.|.|:.|         |...:||.
Human   265 FAEALRAHSCL---SDR--LQYSRIVG---------GWDLLPRALLSS---------LSGLVLLN 306

  Fly   270 TRVVKINWNRNDGRVELQMS----NGETCIADHVVVTVSLGVLKDQHLRL-FEPQLPVEKQRAID 329
            ..||.:....:|..|:::.|    |.:...||.|::|.|...:|    |: |.|.||...|.|:.
Human   307 APVVAMTQGPHDVHVQIETSPPARNLKVLKADVVLLTASGPAVK----RITFSPPLPRHMQEALR 367

  Fly   330 GLAFGTVNKIFVEFPEAFWPEDWTGFTMLWRDEDLDDIRGTSRAWLEDVFGFYRVSYQPR----I 390
            .|.:....|:|:.|...|           ||:|.::.  |.|.........||.   .||    :
Human   368 RLHYVPATKVFLSFRRPF-----------WREEHIEG--GHSNTDRPSRMIFYP---PPREGALL 416

  Fly   391 LAGWITNESGRHMETLPVDEVQAGVMYLFRRFLRWKIPDPANFRTSAWYTNDNFRGSYSYRSMDT 455
            ||.:..:::......|..:|.           ||..:.|.|...                     
Human   417 LASYTWSDAAAAFAGLSREEA-----------LRLALDDVAALH--------------------- 449

  Fly   456 EQLGTGARELSHPLTVVATTPEKDKDSE-------DEAWQQSRCDRPI----VQFAGEASSEHYY 509
               |...|:|.....||....| |:.|:       ...||..:.|..:    :.||||     :.
Human   450 ---GPVVRQLWDGTGVVKRWAE-DQHSQGGFVVQPPALWQTEKDDWTVPYGRIYFAGE-----HT 505

  Fly   510 STVHGAVEAGWREARRLAQFYGISV-SRSGTKS 541
            :..||.||...:.|.|.|    |.: ||.|..|
Human   506 AYPHGWVETAVKSALRAA----IKINSRKGPAS 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7737NP_001286308.1 NAD_binding_8 48..106 CDD:290186 23/72 (32%)
Amino_oxidase 54..526 CDD:279874 123/525 (23%)
IL4I1NP_001244946.1 NAD_binding_8 86..143 CDD:290186 21/59 (36%)
Amino_oxidase 91..523 CDD:279874 124/527 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.