DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7737 and KDM1B

DIOPT Version :9

Sequence 1:NP_001286308.1 Gene:CG7737 / 36174 FlyBaseID:FBgn0033584 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_016865929.1 Gene:KDM1B / 221656 HGNCID:21577 Length:832 Species:Homo sapiens


Alignment Length:533 Identity:123/533 - (23%)
Similarity:210/533 - (39%) Gaps:137/533 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DRKIVVIGAGASGVACATKLLELGFQNVLVVEAEDRLGGRI-HTIPFADNVIDLGAQWCHGERDN 106
            ::.:::||||.:|:|.|.:|...|.: |.|:||:||:|||: ....|....:..|||..:|..:|
Human   391 NKSVIIIGAGPAGLAAARQLHNFGIK-VTVLEAKDRIGGRVWDDKSFKGVTVGRGAQIVNGCINN 454

  Fly   107 IVYELTRKQDEELLESTGPVYENYECVRSNGDVVPEEVSSRLKAIVGDSLVTRQLELRHCSGSLG 171
            .|..:.    |:|..|.....|..:.::..|.:....:..|:                       
Human   455 PVALMC----EQLGISMHKFGERCDLIQEGGRITDPTIDKRM----------------------- 492

  Fly   172 SYLTNKFYDTL---RRPENSDIDAEVASEFFVNYQKF--ENSVEASD------------------ 213
            .:..|...|.:   |:.:....|..:..:....|:.|  |:.::.|:                  
Human   493 DFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHLSNLEYACG 557

  Fly   214 -TLEQVSGRGYLDYWE----CEGDILLNWKDKGYVELLRLLMRSRELNVEHGVLEQRLLLGTRVV 273
             .|.|||.|.: |:.|    ..||..|  ...||..::..|....::.          |...:|.
Human   558 SNLHQVSARSW-DHNEFFAQFAGDHTL--LTPGYSVIIEKLAEGLDIQ----------LKSPQVQ 609

  Fly   274 KINWNRNDGRVELQMSNGETCIADHVVVTVSLGVLKDQHLRLFEPQLPVEKQRAIDGLAFGTVNK 338
            .|:::.::  |::..::|....|..|:|||.|.:|:...:: |.|.|..:|.:||:.|..|.:.|
Human   610 CIDYSGDE--VQVTTTDGTGYSAQKVLVTVPLALLQKGAIQ-FNPPLSEKKMKAINSLGAGIIEK 671

  Fly   339 IFVEFPEAFWPEDWTGFTMLWRDEDLDDIRGTSRAWLEDVFG--------------FYRVSYQPR 389
            |.::||..||.....|                     .|.||              ||.:..|.:
Human   672 IALQFPYRFWDSKVQG---------------------ADFFGHVPPSASKRGLFAVFYDMDPQKK 715

  Fly   390 --ILAGWITNESGRHMETLPVDEVQAGVMYLFRR-FLRWKIPDPANFRTSAWYTNDNFRGSYSYR 451
              :|...|..|:...:.||...:|....|...|. |...::|||..:..:.|.|:...:.:||: 
Human   716 HSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSF- 779

  Fly   452 SMDTEQLGTGARELSHPLTVVATTPEKDKDSEDEAWQQSRCDRPIVQFAGEASSEHYYSTVHGAV 516
                  :.||....::           |..:||        .:..|.|||||::.|:..||.||.
Human   780 ------VKTGGSGEAY-----------DIIAED--------IQGTVFFAGEATNRHFPQTVTGAY 819

  Fly   517 EAGWREARRLAQF 529
            .:|.|||.::|.|
Human   820 LSGVREASKIAAF 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7737NP_001286308.1 NAD_binding_8 48..106 CDD:290186 23/58 (40%)
Amino_oxidase 54..526 CDD:279874 117/517 (23%)
KDM1BXP_016865929.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6365
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.