DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and STX16

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001001433.1 Gene:STX16 / 8675 HGNCID:11431 Length:325 Species:Homo sapiens


Alignment Length:276 Identity:73/276 - (26%)
Similarity:125/276 - (45%) Gaps:51/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GLSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQ 81
            |:.||.:.     :....||:::..|...:.:|: .|..||.|   :.|.| ..|.|.:|...::
Human    81 GVDEIQYD-----VGRIKQKMKELASLHDKHLNR-PTLDDSSE---EEHAI-EITTQEITQLFHR 135

  Fly    82 INEVDKC---KERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPGSS 143
            .....:.   :.|....|..||:....|:|.  |::|..:     |:.|.|:.         |..
Human   136 CQRAVQALPSRARACSEQEGRLLGNVVASLA--QALQELS-----TSFRHAQS---------GYL 184

  Fly   144 RTGSSNSSASQQ------------DNNSFFEDNFFNRKSNQQQMQTQMEEQADLQALEEQEQVIR 196
            :...:....||.            |:|:.:...|       .:.|..:.||..|. :||:|:.||
Human   185 KRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGF-------TEDQLVLVEQNTLM-VEEREREIR 241

  Fly   197 ELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLIL 261
            ::..:|..:|||::.|||::.|||..:|.|:..|||:.|....|.:.|.||..|:.|.||..:||
Human   242 QIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVIL 306

  Fly   262 VGILSAVLLAIILILV 277
              ||..:::.:|::||
Human   307 --ILFVIIIVLIVVLV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 22/98 (22%)
COG5325 <97..276 CDD:227635 53/190 (28%)
SNARE 188..247 CDD:304603 23/58 (40%)
STX16NP_001001433.1 COG5325 75..301 CDD:227635 64/253 (25%)
SNARE_syntaxin16 233..291 CDD:277198 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.