DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and VAM3

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_014749.1 Gene:VAM3 / 854273 SGDID:S000005632 Length:283 Species:Saccharomyces cerevisiae


Alignment Length:284 Identity:65/284 - (22%)
Similarity:120/284 - (42%) Gaps:62/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINEVDKC 88
            :.|:.:|.|..::.:    .:::...::.:.:||.||:.::.      .:|:.   |..:..||.
Yeast    28 KELSNLIETFAEQSR----VLEKECTKIGSKRDSKELRYKIE------TELIP---NCTSVRDKI 79

  Fly    89 KERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYN-------IARP--PGSSR 144
            :...|..|..:|..:|....|.:||:|:                |||       :..|  ||:|:
Yeast    80 ESNILIHQNGKLSADFKNLKTKYQSLQQ----------------SYNQRKSLFPLKTPISPGTSK 128

  Fly   145 TGSS---NSSASQQDNNSFFEDNFFNRKS------NQQQMQTQMEEQADLQALEEQE-------- 192
            ....   .:.|.:||..|.:.....|.:|      .|.|:|.|.|::...|.|.::|        
Yeast   129 ERKDIHPRTEAVRQDPESSYISIKVNEQSPLLHNEGQHQLQLQEEQEQQQQGLSQEELDFQTIIH 193

  Fly   193 ----QVIRELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSY--- 250
                |.|..:...:..||.|:.:||:||.|||..|.:|:..:......:....:.|.:|..:   
Yeast   194 QERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANKQLTRADQHQRD 258

  Fly   251 RNKVRKKKLILVGILSAVLLAIIL 274
            |||..|..||::.::..|:|..:|
Yeast   259 RNKCGKVTLIIIIVVCMVVLLAVL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 18/95 (19%)
COG5325 <97..276 CDD:227635 52/211 (25%)
SNARE 188..247 CDD:304603 17/70 (24%)
VAM3NP_014749.1 COG5325 1..267 CDD:227635 60/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102289
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.