DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and ATSYP24

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_174506.1 Gene:ATSYP24 / 840119 AraportID:AT1G32270 Length:416 Species:Arabidopsis thaliana


Alignment Length:276 Identity:69/276 - (25%)
Similarity:112/276 - (40%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TSIQKVQQNVSTMQR-MVNQLNTPQDSPELKKQL--------------HQIMTYTNQLVTDTNNQ 81
            |.:.::...:|...| ||..|.|....|.::..|              |:.|....|||.||:..
plant   106 TGVYRIDVKLSINFRVMVLHLVTWPMKPVVRCHLKIPLALGSSNSTGGHKKMLLIGQLVKDTSAN 170

  Fly    82 INEVDKCKERH-----LKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPG 141
            :.|..:...|.     .||...:|..:|.|||..||..|..|.:         |..||....|.|
plant   171 LREASETDHRRDVAQSKKIADAKLAKDFEAALKEFQKAQHITVE---------RETSYIPFDPKG 226

  Fly   142 SSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQADL---------QALEEQEQVIRE 197
            |       .|:|:.|..       ::|...|:.:.....::..|         ..:|.:||.|:|
plant   227 S-------FSSSEVDIG-------YDRSQEQRVLMESRRQEIVLLDNEISLNEARIEAREQGIQE 277

  Fly   198 LENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILV 262
            :::.|..|.|::|.|..:|..|| |:|.|:.:::......:||..:|.|||:.:           
plant   278 VKHQISEVMEMFKDLAVMVDHQG-TIDDIDEKIDNLRSAAAQGKSHLVKASNTQ----------- 330

  Fly   263 GILSAVLLAIILILVF 278
            |..|::|.:..|:|.|
plant   331 GSNSSLLFSCSLLLFF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 29/113 (26%)
COG5325 <97..276 CDD:227635 47/187 (25%)
SNARE 188..247 CDD:304603 19/58 (33%)
ATSYP24NP_174506.1 LEA_2 35..137 CDD:281199 8/30 (27%)
Syntaxin_2 <154..219 CDD:291208 21/73 (29%)
SNARE_Qa 268..325 CDD:277193 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 68 1.000 Domainoid score I3465
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.