DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and SYP21

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_197185.1 Gene:SYP21 / 831546 AraportID:AT5G16830 Length:279 Species:Arabidopsis thaliana


Alignment Length:267 Identity:73/267 - (27%)
Similarity:128/267 - (47%) Gaps:37/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINEVDKCKER 91
            :|.:|..|.::...|::..|:||.:.||:|:.||:.:|.:.....::||.:|:.::.|..:. :.
plant    33 SQEVAAGIFRISTAVNSFFRLVNSIGTPKDTLELRDKLQKTRLQISELVKNTSAKLKEASEA-DL 96

  Fly    92 H------LKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPGSSRTGSSNS 150
            |      .||...:|..:|.:.|..||..||..|:.|             |...|..::...::.
plant    97 HGSASQIKKIADAKLAKDFQSVLKEFQKAQRLAAERE-------------ITYTPVVTKEIPTSY 148

  Fly   151 SASQQDNNSFFEDNFFNRKSNQQQ--MQTQMEEQADLQ--------ALEEQEQVIRELENNIVGV 205
            :|.:.|..|.       |.|.||.  :|::.:|...|.        .:||:||.|||:|:.|..|
plant   149 NAPELDTESL-------RISQQQALLLQSRRQEVVFLDNEITFNEAIIEEREQGIREIEDQIRDV 206

  Fly   206 NEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILSAVLL 270
            |.::|.|..:|..||..||.|.|.::.:....:|.|..||||:..:........:|:.|...|||
plant   207 NGMFKDLALMVNHQGNIVDDISSNLDNSHAATTQATVQLRKAAKTQRSNSSLTCLLILIFGIVLL 271

  Fly   271 AIILILV 277
            .:|::::
plant   272 IVIIVVL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 28/101 (28%)
COG5325 <97..276 CDD:227635 53/188 (28%)
SNARE 188..247 CDD:304603 24/58 (41%)
SYP21NP_197185.1 SynN 27..164 CDD:238105 36/151 (24%)
SNARE_Qa 189..247 CDD:277193 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 68 1.000 Domainoid score I3465
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I2079
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102289
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.