DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and SYP23

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001078403.1 Gene:SYP23 / 827494 AraportID:AT4G17730 Length:262 Species:Arabidopsis thaliana


Alignment Length:272 Identity:78/272 - (28%)
Similarity:134/272 - (49%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLQHMENG----------LSGGGGGGLSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQ 55
            |..|.:|.|          ::|||..       |...|.:|:.|.::..:|||..|:||.|.||:
plant     1 MSFQDLEAGRGRSLASSRNINGGGSR-------QDTTQDVASGIFQINTSVSTFHRLVNTLGTPK 58

  Fly    56 DSPELKKQLHQIMTYTNQLVTDTNNQINEVDKCKERHLKIQRDRLVD-----EFTAALTAFQSVQ 115
            |:|||:::||:...|..|||.||:.::.|..:...:....|:.::||     :|.|.|..||..|
plant    59 DTPELREKLHKTRLYIGQLVKDTSAKLKEASETDHQRGVNQKKKIVDAKLAKDFQAVLKEFQKAQ 123

  Fly   116 RKTADIEKTALRQARGDSYN--IARPPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQ 178
            |..|:.|..         |.  :.:|   |...|..||....:.:...|......:|.:|::...
plant   124 RLAAERETV---------YAPLVHKP---SLPSSYTSSEIDVNGDKHPEQRALLVESKRQELVLL 176

  Fly   179 MEEQADLQA-LEEQEQVIRELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTE 242
            ..|.|..:| :||:||.|:|::..|..|:||:|.|..||::||..:|.|.:.::.:....:||..
plant   177 DNEIAFNEAVIEEREQGIQEIQQQIGEVHEIFKDLAVLVHDQGNMIDDIGTHIDNSYAATAQGKS 241

  Fly   243 NLRKASSYRNKV 254
            :|.:...:::::
plant   242 HLVRHQRHKDQI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 36/100 (36%)
COG5325 <97..276 CDD:227635 44/166 (27%)
SNARE 188..247 CDD:304603 21/58 (36%)
SYP23NP_001078403.1 Syntaxin_2 33..133 CDD:291208 36/108 (33%)
SNARE_Qa <204..245 CDD:277193 14/40 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 68 1.000 Domainoid score I3465
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37823
Inparanoid 1 1.050 109 1.000 Inparanoid score I2079
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102289
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X633
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.