DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and Stx17

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_080619.2 Gene:Stx17 / 67727 MGIID:1914977 Length:301 Species:Mus musculus


Alignment Length:273 Identity:60/273 - (21%)
Similarity:107/273 - (39%) Gaps:71/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QRLAQIIATS----IQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINE 84
            |:..:|:..:    ::|.|.|:...||.           .:..:||:......:.|....:.|.|
Mouse    18 QKFTKIVIPTDLERLRKHQINIEKYQRC-----------RIWDKLHEEHINAGRTVQQLRSNIRE 71

  Fly    85 VDK-CKERHLKIQRD------RLVD---EFTAALTA------FQSVQRKTADIEKTALRQARGDS 133
            ::| |    ||:.:|      |::|   |..|..||      .:||:.....:....|.|.    
Mouse    72 MEKLC----LKVHKDDLVLLKRMIDPVKEAAATATAEFLQLHLESVEELKKQVNDEELLQP---- 128

  Fly   134 YNIARP---PGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQADLQALEEQEQVI 195
             ::.|.   .|...||.: .:|||                :..|:....|...|..|.|..|   
Mouse   129 -SLTRSTTVDGVLHTGEA-EAASQ----------------SLTQIYALPEIPQDQNAAESWE--- 172

  Fly   196 RELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLI 260
             .||.:::.::.:...:..||..|...:|||...|...::.|.:||:||:||:.|       ||.
Mouse   173 -TLEADLIELSHLVTDMSLLVSSQQEKIDSIADHVNSAAVNVEEGTKNLQKAAKY-------KLA 229

  Fly   261 LVGILSAVLLAII 273
            .:.:..|::..::
Mouse   230 ALPVAGALIGGVV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 23/115 (20%)
COG5325 <97..276 CDD:227635 44/195 (23%)
SNARE 188..247 CDD:304603 16/58 (28%)
Stx17NP_080619.2 SNARE_syntaxin17 161..222 CDD:277199 18/64 (28%)
Necessary and sufficient for localization to autophagosome. /evidence=ECO:0000250|UniProtKB:P56962 228..274 2/15 (13%)
Endoplasmic reticulum retention signal. /evidence=ECO:0000255 298..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.