DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and stx12l

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_697581.4 Gene:stx12l / 569124 ZFINID:ZDB-GENE-110715-1 Length:267 Species:Danio rerio


Alignment Length:289 Identity:96/289 - (33%)
Similarity:161/289 - (55%) Gaps:40/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLQHMENGLSGGGGGGLSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLH 65
            ||..|.::          ...||..|.|..:::|||:.||...::.|:.||.|..|:|||:.:|.
Zfish     6 MDSSHSQS----------QPRDFNNLTQTCSSNIQKITQNTGQIKSMLFQLGTRPDTPELQDRLQ 60

  Fly    66 QIMTYTNQLVTDTNNQINEV-------DKCKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEK 123
            |:..|||||..:||..:.::       ...::|..:||:|||:::|:|||..||.|||:.|:.|:
Zfish    61 QVQHYTNQLAKETNRHLKDLGTLPQPQSPSEQRQQRIQKDRLMNDFSAALNNFQVVQRRAAERER 125

  Fly   124 TALRQAR-GDSYNIARPPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQME--EQADL 185
            .::.:|| |..:.:             ...:|.:....||      |:...:|||:.|  .:.||
Zfish   126 ESVARARAGSRFQV-------------DELNQDEQLVTFE------KNEGWRMQTEEEPVTEEDL 171

  Fly   186 QALEEQEQVIRELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSY 250
            :.::|:|..||:||::|:.||:|:|.|..::::||..:||||:.||...:.|.:|.|.|:.|:.|
Zfish   172 ELIKERETNIRQLESDIMDVNQIFKDLAVMIHDQGDMIDSIEANVESAEVHVERGAEQLQHAAYY 236

  Fly   251 RNKVRKKKLILVGILSAVLLAIILILVFQ 279
            :.|.||:..||..:||.| ..|..|:::|
Zfish   237 QRKSRKRMCILALVLSLV-ATIFAIIIWQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 39/102 (38%)
COG5325 <97..276 CDD:227635 62/181 (34%)
SNARE 188..247 CDD:304603 24/58 (41%)
stx12lXP_697581.4 Syntaxin_2 26..128 CDD:291208 39/101 (39%)
Syntaxin 29..206 CDD:279182 64/195 (33%)
SNARE_syntaxin12 174..240 CDD:277229 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585961
Domainoid 1 1.000 79 1.000 Domainoid score I8601
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4267
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 1 1.000 - - otm25038
orthoMCL 1 0.900 - - OOG6_102289
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X633
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.