DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and Syx1A

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster


Alignment Length:274 Identity:67/274 - (24%)
Similarity:121/274 - (44%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DFQRLAQIIATSIQKVQQNVSTMQRMVNQ-LNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINEV 85
            ||....:.|...|.|||.||..:::..:. |:.||...:.|::|..:|       .|.....|.|
  Fly    35 DFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQELEDLM-------ADIKKNANRV 92

  Fly    86 -DKCKERHLKIQRDRLVDEFTAAL----TAFQSVQRKTADI------EKTALRQ-ARGDSYNIAR 138
             .|.|.....|:::...::.:|.|    |...::.||..::      .:|..|: .:|.......
  Fly    93 RGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLE 157

  Fly   139 PPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQADLQALEEQEQVIRELENNIV 203
            ..|............::.|:|.|.....        |:||..:|. |..:|.:.|.|.:||.:|.
  Fly   158 ITGRPTNDDELEKMLEEGNSSVFTQGII--------METQQAKQT-LADIEARHQDIMKLETSIK 213

  Fly   204 GVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLIL------V 262
            .:::::..:..||..||..:|.||..||....:|...|::.:||..|::|.|:||:::      :
  Fly   214 ELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILICLTVL 278

  Fly   263 GILSAVLLAIILIL 276
            |||:|..::...|:
  Fly   279 GILAASYVSSYFII 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 25/107 (23%)
COG5325 <97..276 CDD:227635 45/195 (23%)
SNARE 188..247 CDD:304603 17/58 (29%)
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 46/210 (22%)
SNARE 231..281 CDD:399038 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.