DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and stx12

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_009292402.1 Gene:stx12 / 415141 ZFINID:ZDB-GENE-040625-11 Length:267 Species:Danio rerio


Alignment Length:270 Identity:92/270 - (34%)
Similarity:154/270 - (57%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINE-- 84
            ||..|.|..:::|||:..|.:.::.:||||.|..|:..|:::|..:..:||||..:||..:.:  
Zfish    14 DFSSLIQTCSSNIQKITLNTAQIKGLVNQLGTKLDTSGLRERLQYMQHHTNQLAKETNKHLKDLG 78

  Fly    85 -----VDKCKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPGSSR 144
                 |...::|..|||:|||:::|:|||..||:|||:.|:.||.::.:||          ..||
Zfish    79 SISLPVSLSEQRQQKIQKDRLMNDFSAALNNFQAVQRQAAEKEKESVARAR----------AGSR 133

  Fly   145 TGSSNSSASQQ----DNNSFFEDNFFNRKSNQQQMQTQMEEQA----DLQALEEQEQVIRELENN 201
            ..:.:....:|    |||           .:..:..||.|:.|    ||:.::|:|..||:||::
Zfish   134 LSADDGGHDEQLVSFDNN-----------DDWGKTTTQTEDVAITEEDLELIKERETAIRQLESD 187

  Fly   202 IVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILS 266
            |:.||:|:|.|..::::||..:||||:.||...:.|.:|.|.|::|:.|:.|.|||...|...||
Zfish   188 ILDVNQIFKDLAVMIHDQGEMIDSIEANVESAEVHVERGAEQLQRAAQYQQKSRKKICFLAVGLS 252

  Fly   267 AVLLAIILIL 276
            .|:|.|.:::
Zfish   253 IVVLIIGIVI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 38/102 (37%)
COG5325 <97..276 CDD:227635 65/186 (35%)
SNARE 188..247 CDD:304603 24/58 (41%)
stx12XP_009292402.1 Syntaxin_2 23..125 CDD:291208 38/101 (38%)
SNARE_syntaxin12 174..240 CDD:277229 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585963
Domainoid 1 1.000 79 1.000 Domainoid score I8601
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4267
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 1 1.000 - - otm25038
orthoMCL 1 0.900 - - OOG6_102289
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 1 1.000 - - X633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.