DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and Stx16

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_006235755.1 Gene:Stx16 / 362283 RGDID:1309423 Length:326 Species:Rattus norvegicus


Alignment Length:273 Identity:69/273 - (25%)
Similarity:121/273 - (44%) Gaps:44/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GLSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQ 81
            |:.||.:.     :....||:::..|...:.:|: .|..||.|.:..:........||.......
  Rat    81 GVDEIQYD-----VGRIKQKMRELASLHDKHLNR-PTLDDSSEEEHAIEITTQEVTQLFHRCQRA 139

  Fly    82 INEVDKCKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPGSSRTG 146
            :..:.....|....|.:||:....|:|.  |::|..:     |:.|.|:.|..         :..
  Rat   140 VQALPSRARRTCSEQEERLLRNVVASLA--QALQELS-----TSFRHAQSDYL---------KRM 188

  Fly   147 SSNSSASQQ------------DNNSFFEDNFFNRKSNQQQMQTQMEEQADLQALEEQEQVIRELE 199
            .:....||.            |:.:.:...|.:.       |..:.||..| .:||:|:.||::.
  Rat   189 KNREERSQHFFDTPVPLMDDGDDATLYGQGFTDD-------QLVLVEQNTL-VVEEREREIRQIV 245

  Fly   200 NNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGI 264
            .:|..:|||::.|||::.|||..:|.|:..|||:.:....|.:.|.||..|:.|.||..:||  |
  Rat   246 QSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCVKTEDGLKQLHKAEQYQKKNRKMLVIL--I 308

  Fly   265 LSAVLLAIILILV 277
            |.||::.:|::|:
  Rat   309 LVAVIVVLIVVLI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 19/95 (20%)
COG5325 <97..276 CDD:227635 53/190 (28%)
SNARE 188..247 CDD:304603 22/58 (38%)
Stx16XP_006235755.1 SynN 80..>194 CDD:294095 25/134 (19%)
SNARE_syntaxin16 234..292 CDD:277198 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.