DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and Syx5

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_523582.4 Gene:Syx5 / 34966 FlyBaseID:FBgn0011708 Length:467 Species:Drosophila melanogaster


Alignment Length:275 Identity:48/275 - (17%)
Similarity:114/275 - (41%) Gaps:26/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQI----MTYTNQLVTDTNNQI 82
            :|..:|:.|..:|......:..:..:..:.:...|.|:..::|..|    :...||.:.    ::
  Fly   199 EFMMVARFIGKNIASTYAKLEKLTMLAKKKSLFDDRPQEIQELTYIIKGDLNALNQQIA----RL 259

  Fly    83 NEVDKCKER-----HLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPG- 141
            .::.|.:.|     ||......:|....:.|.:..:..::..::....|:|.:......::.|| 
  Fly   260 QDISKDQRRHTNGKHLVSHSSNMVLALQSKLASMSTDFKQILEVRTENLKQQKTRRDQFSQGPGP 324

  Fly   142 ------SSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQME--EQADLQALEEQEQVIREL 198
                  |..|....|....::|.:...|...:..:.....||||.  :.:| ..::::.:.::.:
  Fly   325 LAAHTVSPSTAKQGSLLLSEENQAVSIDMGSSDTTPLLSTQTQMAIYDDSD-NYVQQRAETMQNI 388

  Fly   199 ENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVG 263
            |:.||.:..|:::|..:|.||...|:.|::.|....:.:......:.|   |...|.|.:.:::.
  Fly   389 ESTIVELGGIFQQLAHMVKEQEEIVERIDTNVADAELNIEAAHGEILK---YFQSVSKNRWLMIK 450

  Fly   264 ILSAVLLAIILILVF 278
            |...::...:..:||
  Fly   451 IFGVLIFFFLFFVVF 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 14/104 (13%)
COG5325 <97..276 CDD:227635 32/187 (17%)
SNARE 188..247 CDD:304603 11/58 (19%)
Syx5NP_523582.4 SNARE_syntaxin5 379..451 CDD:277197 15/74 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.