DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and Syx4

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster


Alignment Length:268 Identity:68/268 - (25%)
Similarity:120/268 - (44%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLH-QIMTYTNQLVTDTNNQINEVDK 87
            |:||||.|        |:.||.||...:|....:.....:|| :.:...|||:|..|:....:..
  Fly    96 QQLAQIAA--------NLETMNRMAQTVNLRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPA 152

  Fly    88 CKERHLKIQRDRLVDEFTAALTAFQSVQRKT----ADIEKTALRQARGDSYNIARPPGSSRTGSS 148
            ..:..|:.:..|.:  |......|.::..|.    .:.|....:..|            ..|...
  Fly   153 ENDYSLEARMKRTL--FYGLHQTFINLWHKNELFLQNYETKVKKNLR------------LHTKII 203

  Fly   149 NSSASQQD--------NNSFFEDNFFNRKSNQQQMQTQMEEQADLQALEEQEQVIRELENNIVGV 205
            ||.||:|:        ....|.|||.        .:|:.|.|. |:.:.::...:|.||.:|..|
  Fly   204 NSEASEQEIELLIENKTTKLFVDNFL--------QETEKERQT-LREMMDRFNELRRLEKSIEEV 259

  Fly   206 NEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILSAVLL 270
            :.::.::..||.||...:..:|...:|.::.|.:|.:.|.:|..::.|.||||::|:.||:||||
  Fly   260 HALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLIVILAAVLL 324

  Fly   271 AIILILVF 278
            .::|:.::
  Fly   325 VLLLVGIY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 20/100 (20%)
COG5325 <97..276 CDD:227635 48/190 (25%)
SNARE 188..247 CDD:304603 14/58 (24%)
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 47/207 (23%)
SNARE_syntaxin1-like 238..298 CDD:277201 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.