DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and TSNARE1

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_011515216.1 Gene:TSNARE1 / 203062 HGNCID:26437 Length:838 Species:Homo sapiens


Alignment Length:261 Identity:67/261 - (25%)
Similarity:120/261 - (45%) Gaps:42/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINEV- 85
            :.|.|.|.::.::.::..:|::::|.:..|.||.|:.||:..||.....||:.:..:.:.:.:: 
Human   283 NLQELFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHTAQQETNKTIAASASSVKQMA 347

  Fly    86 ----DKCKERHLKIQR---DRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPGSS 143
                ..|.:..|:.:|   |||..:.:.|:..:..||:|.|:..:..|..|:         .||.
Human   348 ELLRSSCPQERLQQERPQLDRLKTQLSDAIQCYGVVQKKIAEKSRALLPMAQ---------RGSK 403

  Fly   144 RTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQ------MEEQADLQALEEQEQVIRELENNI 202
            :.......|...|     ::..||...|..|.|.|      .||  ||:|:..:|:.|.::|:|:
Human   404 QQSPQAPFAELAD-----DEKVFNGSDNMWQGQEQALLPDITEE--DLEAIRLREEAILQMESNL 461

  Fly   203 VGVNEIYKKLGALVYEQGLTVDSIESQV--EQTS----------IFVSQGTENLRKASSYRNKVR 255
            :.||:|.|.|.::|.|||..|.|..|:.  :|:.          :....|:..||.....|.|.|
Human   462 LDVNQIIKDLASMVSEQGEAVGSSSSKAICQQSCSPEPAAAALLLGAGPGSTPLRPGPHSRTKTR 526

  Fly   256 K 256
            |
Human   527 K 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 23/103 (22%)
COG5325 <97..276 CDD:227635 50/181 (28%)
SNARE 188..247 CDD:304603 20/70 (29%)
TSNARE1XP_011515216.1 Myb_DNA-bind_5 151..225 CDD:290584
Syntaxin_2 292..393 CDD:291208 23/100 (23%)
SNARE 444..>484 CDD:304603 16/39 (41%)
Myb_DNA-bind_5 526..598 CDD:290584 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.