DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and syx-16

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001379771.1 Gene:syx-16 / 175712 WormBaseID:WBGene00022534 Length:329 Species:Caenorhabditis elegans


Alignment Length:269 Identity:58/269 - (21%)
Similarity:115/269 - (42%) Gaps:53/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KVQQNVSTMQRMVNQLNTPQ-------------------DSPELKKQLHQIMTYTNQLVTDTNNQ 81
            :|:..|..:||.:::|...|                   ...:..:|:.|::|:..:|:...:..
 Worm    84 QVEFEVERVQRRLDELGEAQRKHISRPNFGDEAFEKEEKQMEQTTEQITQMLTHCQRLIRMISGS 148

  Fly    82 INEVDKCKERHLK--------IQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIAR 138
            .|: :|..:|.|:        :...::.|||......:.|      ||:.   |....|:|.|..
 Worm   149 HNK-EKPMQRKLRENAAATLSLTLSQITDEFRGRQLKYLS------DIQN---RSRNVDNYLITT 203

  Fly   139 PPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQADLQALEEQEQVIRELENNIV 203
            .|.......:....|.            :.:.:..|:|..|....:::   |:|:.:..:..:|.
 Worm   204 DPLIDAPNWAELDVSP------------STEISMAQLQQFMNNDREVR---EREKEVMAVNTSIR 253

  Fly   204 GVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILSAV 268
            .:|.:::.|..::.:||..:|.|:..||||||.||:..|::.||..|: |..||...:..:..|:
 Worm   254 ELNTLFQDLSEMIVDQGSVIDRIDYNVEQTSIRVSKAVEDVFKAERYQ-KGNKKMHCICMLTVAI 317

  Fly   269 LLAIILILV 277
            :..:|||:|
 Worm   318 IFVLILIIV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 20/116 (17%)
COG5325 <97..276 CDD:227635 42/178 (24%)
SNARE 188..247 CDD:304603 18/58 (31%)
syx-16NP_001379771.1 COG5325 69..316 CDD:227635 53/257 (21%)
SNARE_syntaxin16 238..296 CDD:277198 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.