DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and syx-17

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_492342.1 Gene:syx-17 / 172663 WormBaseID:WBGene00012150 Length:250 Species:Caenorhabditis elegans


Alignment Length:253 Identity:62/253 - (24%)
Similarity:106/253 - (41%) Gaps:76/253 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TMQRMVNQLNTPQ---------DSP-----------ELKKQLHQIMTYTNQLVTDTNNQINEVDK 87
            |..|.:.:|...|         |:|           :|:..|..|:|...:|  ..:.|.||.|.
 Worm     5 TANRQLGELRVLQRIALQGGLRDTPALRDSIAAYEKDLEDGLRGILTVRGEL--HDSRQENEFDS 67

  Fly    88 CKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARP-PGSSRTGSSNSS 151
                        ::|.....:              ||.|        |:.|. |..:..||:...
 Worm    68 ------------IIDPIRQQI--------------KTLL--------NVTRSLPAVNLPGSNPFE 98

  Fly   152 ASQQDNNSF-FEDNFFNR----KSNQ-QQMQTQMEEQADLQALEEQEQVIRELENNIVGVNEIYK 210
            .:.:|:|.: .|...:.|    |.|: :|:...|:|:|:...         ::|.::..:.:|::
 Worm    99 QATEDDNPYEMESRRYLRETTLKDNELRQLADDMKERAEATV---------KIEKDMADLEKIFQ 154

  Fly   211 KLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLI--LVGILS 266
            :||.:|:||...|||||.|||:.:..|.:|.|||:||  .::|..|..|.  :||.|:
 Worm   155 ELGRIVHEQHDVVDSIEEQVERATEDVKRGNENLKKA--VKSKAAKAPLYAGVVGGLA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 18/102 (18%)
COG5325 <97..276 CDD:227635 47/179 (26%)
SNARE 188..247 CDD:304603 20/58 (34%)
syx-17NP_492342.1 SNARE 132..188 CDD:389950 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.