DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and stx16

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_031750392.1 Gene:stx16 / 100493473 XenbaseID:XB-GENE-5943021 Length:323 Species:Xenopus tropicalis


Alignment Length:311 Identity:65/311 - (20%)
Similarity:134/311 - (43%) Gaps:69/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GLSGGGGGGLSEIDFQRLAQIIATS--------------------IQKVQQNVSTMQRMVNQLNT 53
            |.:...|..|.|:...|:|.:...|                    ::::|..|:.:::.:..|.:
 Frog    35 GSARSPGAELDELADDRMALVSGLSLDPEAAIGVTKRLPPKWVDGVEEIQYEVTRIKQKMKDLAS 99

  Fly    54 PQDSPELKKQLHQIMTYTNQLVTDTNNQINEV-DKCKE---------RHLKIQRDRLVDEFTAAL 108
            ..|. .|.:......|.....:..|..::.:: .:|:.         ||...|.:||:....::|
 Frog   100 LHDK-HLNRPTLDDSTEEEHAIEITTQEVTQMFHRCQRSVQSLQSRCRHCTEQEERLLRNVVSSL 163

  Fly   109 TAFQSVQRKTADIEKTALRQARGDSYNIARPPGSSRTGSSNSSASQQDNNSFF-----------E 162
            .  ||:|..:.:...|                   ::|......::::.:..|           |
 Frog   164 A--QSLQDLSTNFRHT-------------------QSGYLKRMKNREERSKHFFDTSVPLMDDGE 207

  Fly   163 DN-FFNRKSNQQQMQTQMEEQADLQALEEQEQVIRELENNIVGVNEIYKKLGALVYEQGLTVDSI 226
            || .::|...:.|:   :..|.:...:||:|:.:|::..:|..:||::::|..:|.|||..:|.|
 Frog   208 DNTLYDRGFTEDQL---VLVQQNTLMVEERERELRQIVQSISDLNEVFRELAGMVVEQGTVLDRI 269

  Fly   227 ESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILSAVLLAIILILV 277
            :..|||..:....|.::|:||..|:.|.||..:||  ||..|::.:|::|:
 Frog   270 DYNVEQACVKTEDGLKHLQKAEQYQKKNRKMLVIL--ILFVVVIVLIVVLI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 19/125 (15%)
COG5325 <97..276 CDD:227635 46/190 (24%)
SNARE 188..247 CDD:304603 19/58 (33%)
stx16XP_031750392.1 COG5325 71..299 CDD:227635 49/252 (19%)
SNARE_syntaxin16 231..289 CDD:277198 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.