DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and Stx12

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_598648.1 Gene:Stx12 / 100226 MGIID:1931027 Length:274 Species:Mus musculus


Alignment Length:274 Identity:90/274 - (32%)
Similarity:158/274 - (57%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GGGGLSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDT 78
            |..|....||..:.|..:.:||::.|..:.::.:::||.|.|||.:|::.|.|:...||||..:|
Mouse    13 GPSGPQPRDFNSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKET 77

  Fly    79 NNQINE-------VDKCKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNI 136
            |..:.|       :...::|..|:|::||:::|::||..||.||||.::.||.::.:|       
Mouse    78 NELLKELGSLPLPLSASEQRQQKLQKERLMNDFSSALNNFQVVQRKVSEKEKESIARA------- 135

  Fly   137 ARPPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQA----DLQALEEQEQVIRE 197
                   |.||..|:..:|.......   |:......|||:|.||.|    ||:.::|:|..||:
Mouse   136 -------RAGSRLSAEDRQREEQLVS---FDSHEEWNQMQSQEEEAAITEQDLELIKERETAIRQ 190

  Fly   198 LENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILV 262
            ||.:|:.||:|:|.|..::::||..:||||:.||.:.:.|.:.|:.|::|:.|:.|.|||..|||
Mouse   191 LEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATDQLQRAAYYQKKSRKKMCILV 255

  Fly   263 GILSAVLLAIILIL 276
            .:||.::..:::::
Mouse   256 LVLSVIVTVLVVVI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 35/102 (34%)
COG5325 <97..276 CDD:227635 63/182 (35%)
SNARE 188..247 CDD:304603 23/58 (40%)
Stx12NP_598648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 2/6 (33%)
SynN 21..164 CDD:238105 45/159 (28%)
Syntaxin 26..213 CDD:279182 64/203 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..147 7/32 (22%)
SNARE_syntaxin12 181..247 CDD:277229 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841632
Domainoid 1 1.000 88 1.000 Domainoid score I7924
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4170
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 1 1.000 - - otm42494
orthoMCL 1 0.900 - - OOG6_102289
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 1 1.000 - - X633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.