DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx7 and tsnare1

DIOPT Version :9

Sequence 1:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001106394.1 Gene:tsnare1 / 100127544 XenbaseID:XB-GENE-5872660 Length:288 Species:Xenopus tropicalis


Alignment Length:290 Identity:86/290 - (29%)
Similarity:146/290 - (50%) Gaps:31/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NGLSGGGGGG-------LSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLH 65
            |..||....|       :.:.:.|.|.||.:..|.::..||.:::|::..|.|..|:.||:.:||
 Frog    15 NPFSGPSTQGYQPLATQIDQNELQELFQITSGDIYRININVQSLERILRSLGTASDTQELRDRLH 79

  Fly    66 QIMTYTNQLVTDTN---NQINEVDKCKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALR 127
            .....||..:|.:.   .|::|..:...|..::|.|||..:.:..:..:..||:|.|:..|:.| 
 Frog    80 FTQQETNNTITSSTKSIRQLSEFVRGSSRQDRLQLDRLRSQLSDIIQRYGVVQKKIAEKSKSLL- 143

  Fly   128 QARGDSYNIARPPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEE-----QADLQA 187
              ..|..:|..|    ||..|:.:.         ::|.||....|.|.|.|.::     :.||..
 Frog   144 --SADQKSIKSP----RTPFSDIAD---------DENIFNGGDEQWQSQKQTQDLTEFSEEDLDE 193

  Fly   188 LEEQEQVIRELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRN 252
            :.::|:.|.::|::::.||:|.|.|.::|||||.|:||||:.:|..|..|......|.|||.::.
 Frog   194 IRQKEEAINQIESDMLDVNQIMKDLASIVYEQGDTIDSIEANIETASSHVESANRQLAKASQHQR 258

  Fly   253 KVRKKKLILVGILSAVLLAIILILVFQFKN 282
            :.||.|..|:.....|||.|::|:|...:|
 Frog   259 RARKLKCCLISAGLLVLLVIVVIIVVSVRN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 26/98 (27%)
COG5325 <97..276 CDD:227635 57/183 (31%)
SNARE 188..247 CDD:304603 22/58 (38%)
tsnare1NP_001106394.1 Syntaxin_2 44..141 CDD:373109 25/96 (26%)
SNARE_TSNARE1 191..254 CDD:277230 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X633
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.