DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and 1700057G04Rik

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001028356.1 Gene:1700057G04Rik / 78459 MGIID:1925709 Length:232 Species:Mus musculus


Alignment Length:229 Identity:59/229 - (25%)
Similarity:106/229 - (46%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GYDCLADLPSVHIEQTFELNDVRLPFAALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGA 131
            |.:.|..:..:.|:|.||..:      |:.|..:.|||.:...||..::.|.|..........||
Mouse    13 GLEYLLHIDHIMIQQQFEFVE------AVLGFETANRYKINDKLGQKVYYAAEDFNFLTLNCCGA 71

  Fly   132 GRPFQMHLLDKTHQEALVFRKKLAMGSMCCQA--KSLEIWIPPGNLLGKVVQSPTFMQPEFFIED 194
            .|||.|.:.|.:.:|.:..|:.|.....||..  :.:||..|||..:|.|:|:....:|:|.:::
Mouse    72 IRPFTMRIFDNSGREVITLRRPLRCDCCCCPCCLQQIEIQAPPGVPVGYVIQTWHPCRPKFTVQN 136

  Fly   195 ESTGQLTFCVEGPVGLGFCCFSLPKDCYFKIHSGGNMRASIDHKWLASK-SQY------------ 246
            |.. |....:.||:    |..::.....|:|       .|:|.:::..: |::            
Mouse   137 EEK-QDVLKIIGPI----CVCNIGGSIDFEI-------KSLDEEFVVGRISKHWSGILKEILTDV 189

  Fly   247 -TTNIYFSDAKLTAKERALILGSAFLLEYLFFQT 279
             |..|.| ...|..|.:|::||:.||::::||::
Mouse   190 DTFGIQF-PLDLDVKMKAVMLGACFLIDFMFFES 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 57/225 (25%)
1700057G04RikNP_001028356.1 LOR 9..222 CDD:382820 59/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.