DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and plscr3a

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001098583.1 Gene:plscr3a / 564882 ZFINID:ZDB-GENE-060531-17 Length:234 Species:Danio rerio


Alignment Length:222 Identity:61/222 - (27%)
Similarity:100/222 - (45%) Gaps:24/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GYDCLADLPSVHIEQTFELNDVRLPFAALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGA 131
            |.:.|..:..:.:.|..||      ..|:.|..:.|:|.:::.:|..||.|.|::....|.:.|.
Zfish    14 GLEYLTQIDQILVHQKIEL------LEAIIGFETNNQYEIKNSMGQKIFHAKENTDCCTRNICGP 72

  Fly   132 GRPFQMHLLDKTHQEALVFRKKLAMGSMC--CQAKSLEIWIPPGNLLGKVVQSPTFMQPEFFIED 194
            .|.|::.:.|...||.:...:.....|.|  |..:.||:..||||.:|.:.|.....:|.|.:.|
Zfish    73 LRSFEIEIRDNFEQEVIHLSRPYRCTSCCFPCCLQELEVQAPPGNPIGYIKQDWHMFKPMFSLYD 137

  Fly   195 ES-TGQLTFCVEGPVGLGFCCFSLPKDCYFKIHSGGNMRASIDHKW-------LASKSQYTTNIY 251
            .| |..||  :|||:....||..:..|...|   .||....|..:|       |.....:..|. 
Zfish   138 MSKTKMLT--IEGPLCAVSCCGDVDFDVLGK---DGNPVGRISKQWAGLIKESLTDSDNFGINF- 196

  Fly   252 FSDAKLTAKERALILGSAFLLEYLFFQ 278
              ...|..|.:|::||:.||::::||:
Zfish   197 --PIDLDVKMKAVLLGACFLIDFMFFE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 59/219 (27%)
plscr3aNP_001098583.1 Scramblase 1..222 CDD:252175 61/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.