DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and Plscr5

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001178928.1 Gene:Plscr5 / 501036 RGDID:1564500 Length:274 Species:Rattus norvegicus


Alignment Length:278 Identity:69/278 - (24%)
Similarity:114/278 - (41%) Gaps:69/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QQPSLSEPRVYDSHISITSQPRPEAPRIPLPVPIATVTGSRTLIPLSGYDCLADLPSVHIEQTFE 84
            |||.:|:|..:                  ||..|         :| .|.:.|:.|..:.|.|..|
  Rat    41 QQPHVSQPSSF------------------LPTAI---------LP-PGLEYLSQLDLIIIHQQVE 77

  Fly    85 LNDVRLPFAALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLDKTHQEALV 149
            |      ...:.|..:.|:|.:::..|..|:.|.|.|...||.:....|...:.:.|.:.:|.:.
  Rat    78 L------LGMILGTETSNKYEIKNSSGQRIYFAVEESICFNRNVCSTLRACTLRITDNSGREVIT 136

  Fly   150 FRKKLAMGS-MC-CQAKSLEIWIPPGNLLGKVVQSPTFMQPEFFIEDESTGQLTFCVEGPVGLGF 212
            ..:.|...| .| |..:.|||..|||.::|.|.|.....||:|.|::.:...:...| ||     
  Rat   137 VNRPLRCNSCWCPCYLQELEIQAPPGTIVGFVAQKWDPFQPKFTIQNANKEDILKIV-GP----- 195

  Fly   213 C----CFSLPKDCYFKIHSGGNMRASIDHKWLASK-SQYTT---NIYFSDA---------KLTAK 260
            |    ||.   |..|::       .::|.|....| |:|.:   |..|::|         .|...
  Rat   196 CTTCGCFG---DVDFEV-------KTVDEKVTIGKISKYWSGFVNDVFTNADNFGIHVPEDLDVT 250

  Fly   261 ERALILGSAFLLEYLFFQ 278
            .:|.::|:.||.:::||:
  Rat   251 LKAAMIGACFLFDFMFFE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 58/229 (25%)
Plscr5NP_001178928.1 Scramblase 48..268 CDD:252175 64/269 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.