DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and Plscr3

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001012139.1 Gene:Plscr3 / 360549 RGDID:1307016 Length:296 Species:Rattus norvegicus


Alignment Length:252 Identity:73/252 - (28%)
Similarity:110/252 - (43%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PRPEAPRIPLP-VPIATVTGSRTLIPLSGYDCLADLPSVHIEQTFELNDVRLPFAALTGVSSENR 103
            |.|..|.:||| ||             ||.:.|..:..:.|.|..|..:..|      |..:.||
  Rat    61 PGPPGPFVPLPGVP-------------SGLEFLVQIDQILIHQKAERVETFL------GWETCNR 106

  Fly   104 YVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLDKTHQEALVFRKKLAMGSMCCQA--KSL 166
            |.:||..|..:..|.|.|....||..||.||.::.|.|...:|.|...:.|..|..||..  :.:
  Rat   107 YELRSGTGQQLGQAAEESNCCARLCCGARRPLRIRLADPGDREVLRLLRPLHCGCSCCPCGLQEM 171

  Fly   167 EIWIPPGNLLGKVVQSPTFMQPEFFIEDESTGQLTFCVEGPVGLGFCC-FSLPKDCYFKIHSGGN 230
            |:..|||..:|.|:|:.....|:|.|.| :..|....|.||     || .....|..|::.:...
  Rat   172 EVQAPPGTTIGHVLQTWHPFIPKFSILD-ADRQPVLRVVGP-----CCTCGCGTDTNFEVKTKDE 230

  Fly   231 MRA--SIDHKWLASKSQYTTN-----IYFSDAKLTAKERALILGSAFLLEYLFFQTR 280
            .|:  .|..:|.....:..|:     :.| ...|..:.:|::||:.||::|:||:.|
  Rat   231 SRSVGRISKQWGGLLREALTDADDFGLQF-PVDLDVRVKAVLLGATFLIDYMFFEKR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 62/220 (28%)
Plscr3NP_001012139.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Proline-rich domain (PRD). /evidence=ECO:0000250|UniProtKB:O15162 1..58
SH3-binding 1. /evidence=ECO:0000255 7..15
PPxY motif. /evidence=ECO:0000255 15..18
SH3-binding 2. /evidence=ECO:0000255 21..27
SH3-binding 3. /evidence=ECO:0000255 66..71 2/4 (50%)
Scramblase 73..285 CDD:252175 66/237 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.