DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and Plscr4

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001012000.1 Gene:Plscr4 / 300900 RGDID:1311693 Length:326 Species:Rattus norvegicus


Alignment Length:283 Identity:67/283 - (23%)
Similarity:117/283 - (41%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VAQQPSL---------SEPRVYD-SHISITSQPRPEAPRIPLPVPIATVTGSRTLIPLSGYDCLA 72
            |.|||..         :.|..|. ....:||||.| ...:|.|.|:....        .|.:.||
  Rat    58 VPQQPGAIPLYHPTGGTHPIQYQPGKYPLTSQPAP-IMWMPGPAPMPNCP--------PGLEYLA 113

  Fly    73 DLPSVHIEQTFELNDVRLPFAALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQM 137
            .|.::|:.|..|      |...:|...:.|||.:::.:...::...|.:.:..|..:...|||.:
  Rat   114 QLDNIHVLQHLE------PLELMTRFETNNRYDIKNNVDQMVYIVTEDTDDFTRNAYRNLRPFVL 172

  Fly   138 HLLDKTHQEALVFRKKLAMGSMC----CQAKSLEIWIPPGNLLGKVVQSPTFMQPEFFIEDESTG 198
            .:.|...:|.:..::.......|    |..:.||:..|||..:|.|.:.....:..:.|::|.. 
  Rat   173 RVTDCLGREIMTMQRPFRCTCCCFCCPCARQELEVQCPPGVTIGFVAEHWNLCRASYSIQNEKK- 236

  Fly   199 QLTFCVEGPVGLGFCCFSLPKDCYFKIHS--GGNMRASIDHKW------LASKSQYTTNIYFSDA 255
            :....|.||.....|    ..|..|:::|  |.:...||..||      :.:...:  .|:|..|
  Rat   237 ESAMRVRGPCATYGC----GSDSVFEVNSLDGASNIGSIIRKWNGFLSTMGNADHF--EIHFPLA 295

  Fly   256 KLTAKERALILGSAFLLEYLFFQ 278
             |..|.:|:|.|..||:::::|:
  Rat   296 -LDVKMKAMIFGCCFLIDFMYFE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 52/222 (23%)
Plscr4NP_001012000.1 Scramblase 96..318 CDD:252175 56/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.