DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and Plscr1

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_035766.2 Gene:Plscr1 / 22038 MGIID:893575 Length:328 Species:Mus musculus


Alignment Length:252 Identity:70/252 - (27%)
Similarity:117/252 - (46%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PRIPLPVPIATVTGSRTLIPLS---GYDCLADLPSVHIEQTFELNDVRLPFAALTGVSSENRYVV 106
            |.:|.|.|           ||:   |.:.||.:..:.:.|..||.:|      |||..:.|:|.:
Mouse    93 PWMPAPPP-----------PLNCPPGLEYLAQIDQLLVHQQIELLEV------LTGFETNNKYEI 140

  Fly   107 RSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLDKTHQEALVFRKKLAMGSMC--CQAKSLEIW 169
            ::.||..::.|.|.:....|...||.|||.:.:||...:|.:...:.|...|.|  |..:.:||.
Mouse   141 KNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQ 205

  Fly   170 IPPGNLLGKVVQSPTFMQPEFFIEDESTGQLTFCVEGPVGLGFCCFSLPKDCYFKIHSGGNMRAS 234
            .|||..:|.|.|:.....|:|.:::|.. |....|.||..:..||    .|..|::       .|
Mouse   206 APPGVPVGYVTQTWHPCLPKFTLQNEKK-QDVLKVVGPCVVCSCC----SDIDFEL-------KS 258

  Fly   235 IDHKWLASK--SQYTTNI--YFSDA---------KLTAKERALILGSAFLLEYLFFQ 278
            :|.:.:..|  .|::..:  .|:||         .|..|.:|::||:.||::::||:
Mouse   259 LDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 62/228 (27%)
Plscr1NP_035766.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 1/2 (50%)
Proline-rich domain (PRD). /evidence=ECO:0000250|UniProtKB:O15162 1..93 70/252 (28%)
SH3-binding 1. /evidence=ECO:0000255 18..26
PPxY motif. /evidence=ECO:0000255 22..25
SH3-binding 2. /evidence=ECO:0000255 56..64
SH3-binding 3. /evidence=ECO:0000255 93..101 4/18 (22%)
Scramblase 107..316 CDD:252175 64/227 (28%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:O15162 269..275 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.