DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and scrm-2

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_493321.1 Gene:scrm-2 / 191509 WormBaseID:WBGene00014200 Length:265 Species:Caenorhabditis elegans


Alignment Length:269 Identity:72/269 - (26%)
Similarity:116/269 - (43%) Gaps:50/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SITSQPRPEAPRIPLPV---PIATVTGSRTLIPLSGYDCLADLPSVHIEQTFELNDVRLPFAALT 96
            :||::|.......|..:   .:..:.|    || :|.:.||.|.:|.:.|..|:.::      ||
 Worm    19 AITTEPGASIQAAPGAIWMEALPAIEG----IP-AGLEYLAYLDTVMVHQVKEVLEI------LT 72

  Fly    97 GVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLDKTHQEALVFRKKL--AMGSM 159
            |..|:|:|.:|:..|...:.|.|.|....|...|:.|.|.||::|..::..|:.:::|  ...|.
 Worm    73 GWESKNKYAIRNKNGQQCYYAFEESNAWERQCCGSQRGFTMHIVDNFNKNVLIVKRELRCCADSF 137

  Fly   160 C---------CQAKSLEIWIPPGNLLGKVVQSPTFMQPEFFIEDESTGQLTFCVEGPVGLGFCCF 215
            |         |..:||..     .|||.|:|........:.|.|:. |.|.|.|:|......||.
 Worm   138 CGCLLGLQNICTIESLST-----GLLGTVLQGYGCTNSFYNILDKD-GNLIFLVDGQGCCTSCCC 196

  Fly   216 SLPKDCYFKIHSGGNMRASIDHKW--LASKSQYTTNIYFSDA---------KLTAKERALILGSA 269
            . .||...|.........||..||  |..::       |:||         .|..|.:|::||:.
 Worm   197 E-DKDFTIKTPDSSVPIGSITKKWGGLLREA-------FTDADTFAVTFPIDLDVKLKAILLGAT 253

  Fly   270 FLLEYLFFQ 278
            ||::::.|:
 Worm   254 FLIDFVEFE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 64/232 (28%)
scrm-2NP_493321.1 LOR 40..263 CDD:295149 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.