DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and LOC102551265

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_006243606.1 Gene:LOC102551265 / 102551265 RGDID:7575278 Length:233 Species:Rattus norvegicus


Alignment Length:223 Identity:57/223 - (25%)
Similarity:102/223 - (45%) Gaps:23/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GYDCLADLPSVHIEQTFELNDVRLPFAALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGA 131
            |.:.|..:..:.|.|.||..:      |:.|..:.|:|.::..||..::.|.|.|....|...|.
  Rat    13 GLEYLLQIDHILIHQQFEFVE------AILGFETANQYKIKDKLGQKVYYAIEDSNFLTRNCCGD 71

  Fly   132 GRPFQMHLLDKTHQEALVFRKKLAMGSM---CCQAKSLEIWIPPGNLLGKVVQSPTFMQPEFFIE 193
            .|||.|.::|.:..|.:..::.|...|.   ||..| :|:..|||..:|.::|:....:|:|.::
  Rat    72 NRPFSMRIIDNSGHEVITLQRPLRCDSCFCPCCLQK-MEVQAPPGVPIGYIIQTWHPCRPKFTVQ 135

  Fly   194 DESTGQLTFCVEGPVGLGFCCFSLPKDCYFKIHSGGNMRASIDHKWLASKSQYTTNIYFSDA--- 255
            :|.. |....:.||:..  |.|....|...|......:...|...|.....:..|::   |:   
  Rat   136 NEEK-QDVLKIIGPIIT--CSFGGNVDFEIKSLDEAFVVGRISKHWSGFLKEILTDV---DSFGI 194

  Fly   256 ----KLTAKERALILGSAFLLEYLFFQT 279
                .|..|.:|::||:.||::::||::
  Rat   195 QFPLDLDVKIKAVMLGACFLIDFMFFES 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 55/219 (25%)
LOC102551265XP_006243606.1 Scramblase 10..222 CDD:252175 57/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.