DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and LOC100536708

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_003197974.1 Gene:LOC100536708 / 100536708 -ID:- Length:273 Species:Danio rerio


Alignment Length:251 Identity:57/251 - (22%)
Similarity:91/251 - (36%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PIATVTGSRTLIPLSGYDCLADLPSVHIEQTFELNDVRLPFAALTGVSSENRYVVRSPLGDAIFA 116
            |..|.|.|:||..|:   .|..:..:||....||...:........:.||||        |.:|.
Zfish    54 PANTHTESKTLGKLT---ALRTVTRLHITARPELQGPQCVARRTYSICSENR--------DQLFV 107

  Fly   117 ANESSTEKNRLLWGAGRPFQMHLLDKTHQEALVFRKKLAMGSMCCQA---KSLEIWIPPGNLLGK 178
            |.|.|:.......|..|...:...||..:...:|.:.| ...|||..   ..:..:.....|:|.
Zfish   108 AVEESSCMCMQCCGPARSCSLRGFDKDSECVFLFERPL-RADMCCLGCCLMEIRAYTAERELIGT 171

  Fly   179 VVQSPTFMQPEFFIEDESTGQLTFCVEGPVGLGFCCFSLPKDC------------------YFKI 225
            |.|..:...|...:.| |.|.....::|.     ||.:   .|                  .:|.
Zfish   172 VHQRWSMFTPYLEVCD-SEGISAMRIQGS-----CCNT---RCLSEQELQVVSTIGESIGRIWKK 227

  Fly   226 HSGGNMRASIDHKWLASKSQYTTNIYFS---DAKLTAKERALILGSAFLLEYLFFQ 278
            ..|.|.:.::||:            ||.   ..:::...:.|:|.:||||.::||:
Zfish   228 WPGYNDKCNMDHE------------YFGLDVPQEMSLNTKVLLLAAAFLLNHMFFE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 48/234 (21%)
LOC100536708XP_003197974.1 LOR 95..271 CDD:295149 44/205 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.