DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9084 and plscr4

DIOPT Version :9

Sequence 1:NP_001260884.1 Gene:CG9084 / 36172 FlyBaseID:FBgn0033582 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_002942920.2 Gene:plscr4 / 100488434 XenbaseID:XB-GENE-6449820 Length:205 Species:Xenopus tropicalis


Alignment Length:232 Identity:47/232 - (20%)
Similarity:91/232 - (39%) Gaps:38/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VTGSRTLIPLSGYDCLADLPSVHIEQTFELNDVRLPFAALTGVSSENRYVVRSPLGDAIFAANES 120
            :.|:..:.|  |.:.|..:..:.|:||..           :...:...|.:.:|.|..::.|.|:
 Frog     1 MAGTPVIPP--GLENLLQMDEIWIKQTRH-----------STFQNHCTYDLLTPSGALLYRAEET 52

  Fly   121 STEKNRLLWGAGRPFQMHLLDKTHQEALVFRKKLAMGSMCCQAKSLEIWIPPGNLLGKVVQSPTF 185
            ..       ..|..|.:.:.:...|:.|   ..|...|.|.....|:::...|.|||.:  :.|:
 Frog    53 RE-------CCGPRFDVSVQNLHGQQVL---SLLLPSSYCTWETQLQVFSGTGTLLGYI--NKTW 105

  Fly   186 MQPEFFIEDESTGQLTFCVEGP-VGLGFCCFSLPKDCYFKIHSGGNMRA--SIDHKWLASKSQ-Y 246
            ....|.|. ..|.:.:..|:|| .|.||.     .|..|::...|:..|  .|...|...|.: :
 Frog   106 ASMNFTIL-TPTREKSLEVQGPGWGGGFM-----SDVNFQVTMYGSHAAFGLITRVWRGVKKEFF 164

  Fly   247 TTNIYFS---DAKLTAKERALILGSAFLLEYLFFQTR 280
            :.|.|::   ...|....:||::.....:::.:::.|
 Frog   165 SPNDYYAIKFPRDLDVNVKALLVACTIYIDFTYYEAR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9084NP_001260884.1 LOR 66..277 CDD:295149 44/217 (20%)
plscr4XP_002942920.2 LOR 8..199 CDD:413170 45/221 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.