DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and ZNF518A

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001265453.1 Gene:ZNF518A / 9849 HGNCID:29009 Length:1483 Species:Homo sapiens


Alignment Length:264 Identity:49/264 - (18%)
Similarity:78/264 - (29%) Gaps:101/264 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PSSAQKKKYQPSSTASVGPFECPNCDLTFSRKQSYVLHRKTHERIEHACPICGK----------- 450
            |:..| |.:|......:..:.|..|:.:.:..|.:..||:||......|.||..           
Human   132 PNDLQ-KHFQMWHHGELPSYPCEMCNFSANDFQVFKQHRRTHRSTLVKCDICNNESVYTLLNLTK 195

  Fly   451 -----------------KFKVE--WAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHD 496
                             ||..:  ..:..|:.||.:  .|::|..|..:...:.||:.|:   |.
Human   196 HFTSTHCVNGNFQCEKCKFSTQDVGTFVQHIHRHNE--IHYKCGKCHHVCFTKGELQKHL---HI 255

  Fly   497 EHG-FIYECKRCQRTFLTQQRLQRHQAV------------------------------------- 523
            ..| |.:.|:.|......::.|.||...                                     
Human   256 HSGTFPFTCQYCSYGATRREHLVRHVITLHKEHLYAKEKLEKDKYEKRMAKTSAGLKLILKRYKI 320

  Fly   524 ---------------GCQRHKEDSVRI----------KEEQSRFKQE--SRSKDDRHHGNNSSKR 561
                           |..|..|.:.::          .|:||...||  |..||:|.|..|:.|.
Human   321 GASRKTFWKRKKINSGSDRSIEKNTQVLKKMNKTQTKSEDQSHVVQEHLSEEKDERLHCENNDKA 385

  Fly   562 RPGE 565
            ...|
Human   386 PESE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 5/21 (24%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-C2H2 443..465 CDD:278523 6/51 (12%)
C2H2 Zn finger 445..465 CDD:275368 6/49 (12%)
C2H2 Zn finger 474..491 CDD:275368 4/16 (25%)
C2H2 Zn finger 504..521 CDD:275368 4/16 (25%)
ZNF518ANP_001265453.1 C2H2 Zn finger 179..201 CDD:275368 3/21 (14%)
C2H2 Zn finger 209..229 CDD:275368 3/19 (16%)
C2H2 Zn finger 236..256 CDD:275368 6/22 (27%)
C2H2 Zn finger 264..281 CDD:275368 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..415 13/40 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1164..1188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.