DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and STP4

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_010235.1 Gene:STP4 / 851512 SGDID:S000002206 Length:490 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:65/317 - (20%)
Similarity:102/317 - (32%) Gaps:122/317 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RERKKEEPVDEDQCRVCTSKEELVCLF------KKQIDATPADMLLVICPNVSILPKDFMPQFIC 286
            ::|||:|      |.:|.:       |      .|....||.|.... ||             ||
Yeast   272 KQRKKKE------CPICHN-------FYANLSTHKSTHLTPEDRPHK-CP-------------IC 309

  Fly   287 TKCMGSLTIAIQLRKQLETTDQELRKRLSRSKNKVRRPR-----GYVVIDAPVTDSSEDEDELDD 346
                                    ::..:|:.:.:|..:     .::.|.|..:|::...|:.||
Yeast   310 ------------------------QRGFARNNDLIRHKKRHWKDEFMQIYARESDNNSGADDQDD 350

  Fly   347 EFKVSDVAGTTSADSDSADSDDSEKEKKKPGPRGRPRKKPLKRGTDSDGEPSSAQKKKYQPSSTA 411
                   ...|||::||.||:|                   |....|..|.:...||....|...
Yeast   351 -------TARTSANNDSDDSND-------------------KLAASSSSEETKLLKKNQLKSLYK 389

  Fly   412 SVGPFECP------NCDLTFSRKQSYVLHRKTHERIEHACPICGKKFKVEWAYKTHMQRHEQERA 470
            ..|.|:||      |.|:.....:|..|:   .|.|.  |...|...:.: .:|.|:     :..
Yeast   390 IKGAFKCPYNSTLINLDMEVYPHKSRSLY---FEPIN--CHQTGVFSRCD-TFKNHL-----KAL 443

  Fly   471 HFRCELCPKIFRLRAELKHHMAQRHDEHGFI-YECKRCQRTF-LTQQRLQRHQAVGC 525
            ||  |..||             .:.::.|.: .:||.|...| .....|.:|...||
Yeast   444 HF--EYPPK-------------TKKEDRGVVPGKCKHCGLQFPNVDVWLNKHVGKGC 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 11/78 (14%)
zf-C2H2 416..438 CDD:278523 7/27 (26%)
C2H2 Zn finger 418..438 CDD:275368 6/25 (24%)
zf-C2H2 443..465 CDD:278523 4/21 (19%)
C2H2 Zn finger 445..465 CDD:275368 4/19 (21%)
C2H2 Zn finger 474..491 CDD:275368 3/16 (19%)
C2H2 Zn finger 504..521 CDD:275368 5/17 (29%)
STP4NP_010235.1 COG5048 14..442 CDD:227381 51/257 (20%)
C2H2 Zn finger 279..296 CDD:275368 4/23 (17%)
C2H2 Zn finger 306..326 CDD:275368 6/56 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.