DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and AT3G29340

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:375 Identity:78/375 - (20%)
Similarity:112/375 - (29%) Gaps:119/375 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 TKCMGSLTIAIQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSEDEDELDDEFKVS 351
            |.|.|    .|.||..|::......|...:|....:...|:..|..|:.:....:     ||  |
plant    25 TTCSG----VIALRSNLQSKSSHKCKICGKSFECYQALGGHQRIHRPIKEKLSKQ-----EF--S 78

  Fly   352 DVAGTTSADSDSADSDDSEKEKKKPGP-----RG--------RPRKKPLKRGTDSDGEPSSAQKK 403
            :|....|......:|..|..|.|..|.     ||        |..|:.|....|.:....|::.|
plant    79 EVYPRKSKLQKRPESSSSCYECKVCGKIFGCYRGLGGHTKLHRSTKRELASTQDENSLLDSSEAK 143

  Fly   404 KY--QPSS--TASVGPF-ECPNCDLTFSRKQSY----------VLHRKTHERIEHACPICGKKFK 453
            |.  ||||  .:....| .|......||...|:          .|..||..:....|.||||.|.
plant   144 KIVSQPSSFKVSQEEKFLHCVELKQDFSEPLSHSGALPSTLRSKLQTKTQWKSSCHCKICGKSFV 208

  Fly   454 VEWAYKTHMQRHEQERAHFRCE--------------------LCPKIFRLR--------AELKHH 490
            .......|.:.|.:......|:                    ..|..|.:.        .|||..
plant   209 CSQGLGNHKRVHREISGKLACKRKYTEDYNPFSDSLKAKKIVKKPSSFEVSQEEKILHCVELKQD 273

  Fly   491 MAQRHDEHGF---------------------------------------IYECKRCQRTFLTQQR 516
            ..:.....||                                       ::.||.|.|.|.|.:.
plant   274 FGELLAHSGFDKSISCSKSIKVKKVARKNEKTEDSTSLFGVFVGEMSQRLHGCKTCGRKFGTLKG 338

  Fly   517 LQRHQAVGCQRHKEDSVRIKEEQS-----RFKQESR----SKDDRHHGNN 557
            :..||    :.|..:..||::|..     ..|::||    |..||..|::
plant   339 VYGHQ----RMHSGNHNRIEDENGLERIWGLKKKSRVCSVSAFDRFKGSS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 7/25 (28%)
zf-C2H2 416..438 CDD:278523 7/32 (22%)
C2H2 Zn finger 418..438 CDD:275368 6/29 (21%)
zf-C2H2 443..465 CDD:278523 7/21 (33%)
C2H2 Zn finger 445..465 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..491 CDD:275368 6/44 (14%)
C2H2 Zn finger 504..521 CDD:275368 6/16 (38%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 4/24 (17%)
C2H2 Zn finger 45..65 CDD:275368 3/19 (16%)
C2H2 Zn finger 100..120 CDD:275368 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.