DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Zfp202

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_109638.2 Gene:Zfp202 / 80902 MGIID:1933401 Length:641 Species:Mus musculus


Alignment Length:618 Identity:130/618 - (21%)
Similarity:201/618 - (32%) Gaps:198/618 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GEQRQNPQESAQNQE--QPQPRQDLAGKSVGSADDGVSGTVGQIMDYLEDDA---GATADQDAEM 72
            |::.::.:|:....|  |.|||:.....:|     .|.|     .:.|.::.   |...:..:| 
Mouse   108 GQRPESGEEAVTLVEGLQKQPRRPRRWVTV-----HVQG-----QEVLSEETLHLGLEPESSSE- 161

  Fly    73 GEAEYLDGEMPQEDESETPQTEKANEGCQESSNKKDLQESAAKDDFSKEKSGEDGEKDTDKEKKA 137
                       |:|.::|..||:.:|   |:....||                    .|.:::..
Mouse   162 -----------QQDPTQTLTTEQPHE---EALRSPDL--------------------GTQEQETL 192

  Fly   138 THLHEDNNDDAEKDGDEADAEDEDDVEKP------------------------------------ 166
            .|      |:......|.:.....||:.|                                    
Mouse   193 QH------DEEHLPLPECEVPVSQDVDLPTEQGSGHPEMVALLTALSQGLVTFKDVALCFSQDQW 251

  Fly   167 EDEDGTEE---GDEAIEED----------EDALDEDEDPNEEVEEIEPDFETGTDAEGELITGDE 218
            .|.|.|::   |:..:|||          ...||:.....||..::....|:...||.|:::...
Mouse   252 SDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDDTSQIREEEPQVPGVHESQEPAEPEILSFTY 316

  Fly   219 PGDLADVPIRERKKEEPVDEDQCRVCTSKEELVCLFKKQIDATPADMLLVICPNVSILPKDF--- 280
            .||:::.      :||.|::......|       |...::..:| |..:||..|.|.|.:.|   
Mouse   317 TGDMSEA------EEESVEQQDTHKST-------LANTEVHQSP-DWEIVIEDNTSRLNERFGTN 367

  Fly   281 -------------MP-------QFICTKCMGSLTIAIQLRKQLETTD-------QELRKRLSRSK 318
                         ||       |..|..|..|.|....|.:.|.|..       .|..|..:||.
Mouse   368 VSKVNSFTNIRETMPVHSQSGRQHHCPLCAKSFTCNSHLIRHLRTHTGEKPYKCMECGKSYTRSS 432

  Fly   319 NKVR------------RPRGYVVIDAPVTDSSEDEDELDDEFKVSDVAGTTSADSDSADSDDSEK 371
            :..|            .|.....:|.|:..|.                 .|:........||..|
Mouse   433 HLARHQKVHKMNTPHKHPPNRKTVDGPLVQSE-----------------VTTRVEKPYTCDDCGK 480

  Fly   372 EKKKPGPRGRPRKKPLKRGTDSDGEP--------SSAQKKKYQPSSTASVG--PFECPNCDLTFS 426
            ..:......|.::      |.:..:|        |.:||..........||  |:.|.||...||
Mouse   481 HFRWTSDLVRHQR------THTGEKPFFCTICSKSFSQKSVLTTHQRIHVGGKPYVCANCGENFS 539

  Fly   427 RKQSYVLHRKTHERIE-HACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHH 490
            .::.|:.|||||...| |.|..||:.|....|:..|::.|...| :.||:.|.|.|..|..|..|
Mouse   540 EQKQYLTHRKTHVSEEHHLCNECGRSFSHSAAFAKHLKGHASVR-NCRCDECGKTFSRRDHLVRH 603

  Fly   491 MAQRHDEHGFIYECKRCQRTFLTQQRLQRHQAV 523
            ......|..|  .|..|.::|.....|.|||.|
Mouse   604 QRTHTGEKPF--TCATCGKSFSRGYHLIRHQRV 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 21/102 (21%)
zf-C2H2 416..438 CDD:278523 9/21 (43%)
C2H2 Zn finger 418..438 CDD:275368 9/19 (47%)
zf-C2H2 443..465 CDD:278523 7/21 (33%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368 6/16 (38%)
C2H2 Zn finger 504..521 CDD:275368 5/16 (31%)
Zfp202NP_109638.2 SCAN 43..153 CDD:128708 11/54 (20%)
KRAB 237..297 CDD:214630 11/59 (19%)
COG5048 <332..624 CDD:227381 76/325 (23%)
C2H2 Zn finger 393..413 CDD:275368 6/19 (32%)
C2H2 Zn finger 421..441 CDD:275368 5/19 (26%)
C2H2 Zn finger 475..495 CDD:275368 4/25 (16%)
C2H2 Zn finger 503..523 CDD:275368 3/19 (16%)
C2H2 Zn finger 531..551 CDD:275368 9/19 (47%)
C2H2 Zn finger 559..579 CDD:275368 6/19 (32%)
C2H2 Zn finger 587..607 CDD:275368 7/19 (37%)
C2H2 Zn finger 615..635 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.