DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and ZSCAN5A

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001308993.1 Gene:ZSCAN5A / 79149 HGNCID:23710 Length:496 Species:Homo sapiens


Alignment Length:393 Identity:90/393 - (22%)
Similarity:144/393 - (36%) Gaps:104/393 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 TEEGDEAIEEDEDALDEDEDPNEEVEEIEPDFETGTDAEGELITGDEPGD---------LADVPI 227
            |..|.|.|.:|.| ::..|.|:    .:..|.:..:......:....||:         |..||.
Human   132 TFHGKEYIVQDSD-IEMAEAPS----SVRDDLKDVSSQRASSVNQMRPGEGQAHRELQILPRVPA 191

  Fly   228 RERKKEEPVDEDQCRVCTSKEELVCLFKKQIDATPADMLLVICPNVSILPKDFMPQFICTKCMGS 292
            ..|::.|..                |..|.||.| .|            ||...|:         
Human   192 LSRRQGEDF----------------LLHKSIDVT-GD------------PKSLRPK--------- 218

  Fly   293 LTIAIQLRKQLETTDQELRKRLSRSKNK----------------VRRPRGYVVIDAPVTDSSEDE 341
                       :|.:::|::  :|.:|.                ||...|.   |.|...|.|:.
Human   219 -----------QTLEKDLKE--NREENPGLTSPEPQLPKSPTDLVRAKEGK---DPPKIASVENV 267

  Fly   342 D-ELDDEFKVSDVAGTTSADSDSADSDDSEKEKK-------KPGPRGRP-----RKKPLKRGTDS 393
            | :......|...|.|.|.:...|.:..|.|..|       :..|:|..     |:.|.:.|.:|
Human   268 DADTPSACVVEREASTHSGNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNS 332

  Fly   394 DGEPSSAQKKKYQPSSTA-SVGPFECPNCDLTFSRKQSYVLHRKTH--ERIEHACPICGKKFKVE 455
            ...|..|....:.....| ::.||.|..|:..|:.....|:|:::|  ||: ..|.:|||:|...
Human   333 IHSPGPASPVSHPDGQEAKALPPFACDVCEKRFTCNSKLVIHKRSHTGERL-FQCNLCGKRFMQL 396

  Fly   456 WAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRH 520
            .:.:.|.:.|..||. :.|::|.|.|..::.||.|......|..|  |||.|::.|..:..|:.|
Human   397 ISLQFHQRTHTGERP-YTCDVCQKQFTQKSYLKCHKRSHTGEKPF--ECKDCKKVFTYRGSLKEH 458

  Fly   521 QAV 523
            |.:
Human   459 QRI 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 11/72 (15%)
zf-C2H2 416..438 CDD:278523 6/21 (29%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-C2H2 443..465 CDD:278523 6/21 (29%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368 6/16 (38%)
C2H2 Zn finger 504..521 CDD:275368 5/16 (31%)
ZSCAN5ANP_001308993.1 SCAN 40..124 CDD:153421
2a38euk <117..>328 CDD:130009 49/254 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..183 3/34 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..348 36/182 (20%)
COG5048 <339..492 CDD:227381 38/127 (30%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
zf-H2C2_2 398..423 CDD:404364 8/25 (32%)
C2H2 Zn finger 414..434 CDD:275368 7/19 (37%)
zf-H2C2_2 430..451 CDD:404364 8/22 (36%)
C2H2 Zn finger 442..462 CDD:275368 7/20 (35%)
zf-H2C2_2 454..479 CDD:404364 3/8 (38%)
C2H2 Zn finger 470..490 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.