DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and OVOL3

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_016882679.1 Gene:OVOL3 / 728361 HGNCID:14186 Length:213 Species:Homo sapiens


Alignment Length:173 Identity:44/173 - (25%)
Similarity:68/173 - (39%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 PGPRGRPRKK---------------PLKRGTDSDGEPSSAQKKKYQPSSTASVGPFECPNCDLTF 425
            ||.:|:.|:.               |..:.:.|..:|.:|..:....|:....|...||.|...|
Human    38 PGGKGQERRSVTIWLFSSDCSSLGGPPAQQSSSVRDPWTAPTQGNLTSAPRGPGTLGCPLCPKAF 102

  Fly   426 SRKQSYVLHRKTHERI-EHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKH 489
            ..::....|.|.|..: .|.|..|||.|...:..|.||:.|...|. |||..|.|.|..|..|:.
Human   103 PLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRHMRTHTGIRP-FRCSACGKAFTQRCSLEA 166

  Fly   490 HMAQRH---------DEHGFIYECKRCQRTFLTQQRLQRHQAV 523
            |:|:.|         :....::.|:.|..|........:|:|:
Human   167 HLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQHRAL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 6/21 (29%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-C2H2 443..465 CDD:278523 9/21 (43%)
C2H2 Zn finger 445..465 CDD:275368 8/19 (42%)
C2H2 Zn finger 474..491 CDD:275368 6/16 (38%)
C2H2 Zn finger 504..521 CDD:275368 3/16 (19%)
OVOL3XP_016882679.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.