DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Zfp518a

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_082595.1 Gene:Zfp518a / 72672 MGIID:1919922 Length:1478 Species:Mus musculus


Alignment Length:214 Identity:48/214 - (22%)
Similarity:72/214 - (33%) Gaps:46/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PSSAQKKKYQPSSTASVGPFECPNCDLTFSRKQSYVLHRKTHERIEHACPICGKKFKVEWAY--- 458
            |:..| |.::......:..|.|..|..:.|..|.:..|||||......|.||..    |.:|   
Mouse   134 PNDLQ-KHFEMWHHGELPSFPCEMCSFSASDFQIFKQHRKTHRNTFVKCDICNS----ERSYTLL 193

  Fly   459 --KTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQ 521
              ..|.........:|:||.|....:.......|:.:..:.|   |:|.:|.....|:..||:|.
Mouse   194 DLTKHFTSKHCVNGNFQCEECRFFTQDVGTFVQHIHRHKEVH---YKCGKCHHLCFTKGELQKHL 255

  Fly   522 AVG----------CQR---HKEDSVR-----------IKEEQSRFKQESRSKDDRHHGNNSSKRR 562
            .|.          |..   ||:..:|           .||:..|.:.:.|.......|.....:|
Mouse   256 RVHSGTLPFTCHYCSYGAIHKDQLIRHVITLHKEHLYAKEKLERDQYDKRVAKTTTTGLKLILKR 320

  Fly   563 PGEGRDLFKAVAPPTTTYW 581
            ...|         ||.|:|
Mouse   321 YKIG---------PTKTFW 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 8/21 (38%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-C2H2 443..465 CDD:278523 6/26 (23%)
C2H2 Zn finger 445..465 CDD:275368 6/24 (25%)
C2H2 Zn finger 474..491 CDD:275368 3/16 (19%)
C2H2 Zn finger 504..521 CDD:275368 5/16 (31%)
Zfp518aNP_082595.1 C2H2 Zn finger 181..203 CDD:275368 6/25 (24%)
C2H2 Zn finger 211..231 CDD:275368 4/19 (21%)
C2H2 Zn finger 238..258 CDD:275368 6/19 (32%)
C2H2 Zn finger 266..283 CDD:275368 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..393
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 569..603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..696
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1282..1305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.