Sequence 1: | NP_610639.1 | Gene: | CG12391 / 36170 | FlyBaseID: | FBgn0033581 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082595.1 | Gene: | Zfp518a / 72672 | MGIID: | 1919922 | Length: | 1478 | Species: | Mus musculus |
Alignment Length: | 214 | Identity: | 48/214 - (22%) |
---|---|---|---|
Similarity: | 72/214 - (33%) | Gaps: | 46/214 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 397 PSSAQKKKYQPSSTASVGPFECPNCDLTFSRKQSYVLHRKTHERIEHACPICGKKFKVEWAY--- 458
Fly 459 --KTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQ 521
Fly 522 AVG----------CQR---HKEDSVR-----------IKEEQSRFKQESRSKDDRHHGNNSSKRR 562
Fly 563 PGEGRDLFKAVAPPTTTYW 581 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12391 | NP_610639.1 | zf-AD | 240..313 | CDD:285071 | |
zf-C2H2 | 416..438 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 443..465 | CDD:278523 | 6/26 (23%) | ||
C2H2 Zn finger | 445..465 | CDD:275368 | 6/24 (25%) | ||
C2H2 Zn finger | 474..491 | CDD:275368 | 3/16 (19%) | ||
C2H2 Zn finger | 504..521 | CDD:275368 | 5/16 (31%) | ||
Zfp518a | NP_082595.1 | C2H2 Zn finger | 181..203 | CDD:275368 | 6/25 (24%) |
C2H2 Zn finger | 211..231 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 238..258 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 266..283 | CDD:275368 | 4/16 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 356..393 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 569..603 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 658..696 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1282..1305 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167847315 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |