DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and OVOL2

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_067043.2 Gene:OVOL2 / 58495 HGNCID:15804 Length:275 Species:Homo sapiens


Alignment Length:306 Identity:67/306 - (21%)
Similarity:110/306 - (35%) Gaps:77/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 MPQFICTKCMGSLTIAIQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSEDEDELD 345
            ||:....|   ..::.:.:|...|..|::      |:...:....|.::.|.|       ||...
Human     1 MPKVFLVK---RRSLGVSVRSWDELPDEK------RADTYIPVGLGRLLHDPP-------EDCRS 49

  Fly   346 DEFKVSDVAGTTSADSDSADSDDS----EKEKKKPGPRGRPRKKPLKRGTDSDG------EPSSA 400
            |....|....:::.:...|:|..|    |.|..:||....|           ||      .|.:.
Human    50 DGGSSSGSGSSSAGEPGGAESSSSPHAPESETPEPGDAEGP-----------DGHLATKQRPVAR 103

  Fly   401 QKKKYQPSSTASVGPFECPNCDLTFSRKQSYVLHRKTHERIE-HACPICGKKFKVEWAYKTHMQR 464
            .|.|:...:.:......|..|...|..::....|.|.|.::: |.|..|||.|...:..|.|::.
Human   104 SKIKFTTGTCSDSVVHSCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRT 168

  Fly   465 HEQERAHFRCELCPKIFRLRAELKHHM------------AQRHDEHGFIYECKRCQRTFLTQQRL 517
            |...|. ::|.:|.|.|..|..|:.|:            .||.|:   :|.|:.|..|..||:.|
Human   169 HTGIRP-YKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDK---LYVCEDCGYTGPTQEDL 229

  Fly   518 QRH----------------------QAVGCQRHKEDSVRIKEEQSR 541
            ..|                      |......|:|:: .:.||:.|
Human   230 YLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENT-SLSEEEER 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 6/31 (19%)
zf-C2H2 416..438 CDD:278523 5/21 (24%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-C2H2 443..465 CDD:278523 8/21 (38%)
C2H2 Zn finger 445..465 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..491 CDD:275368 6/16 (38%)
C2H2 Zn finger 504..521 CDD:275368 7/38 (18%)
OVOL2NP_067043.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..101 21/109 (19%)
C2H2 Zn finger 121..141 CDD:275368 5/19 (26%)
C2H2 Zn finger 149..169 CDD:275368 7/19 (37%)
zf-H2C2_2 161..186 CDD:316026 8/25 (32%)
C2H2 Zn finger 177..198 CDD:275368 7/20 (35%)
C2H2 Zn finger 216..233 CDD:275368 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156931
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.