DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12391 and ZNF317

DIOPT Version :9

Sequence 1:	NP_610639.1	Gene:	CG12391 / 36170	FlyBaseID:	FBgn0033581	Length:	587	Species:	Drosophila melanogaster
Sequence 2:	NP_065984.3	Gene:	ZNF317 / 57693	HGNCID:	13507	Length:	595	Species:	Homo sapiens

Alignment Length:	184	Identity:	47/184 - (25%)
Similarity:	70/184 - (38%)	Gaps:	46/184 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   415 PFECPNCDLTFSRKQSYVLHRKTH-------------------ERIEH----------ACPICGK 450
            |:.|..|...|..|.::.||:|.|                   .|.:|          .|..|||
Human   361 PYACTQCGKAFRWKSNFNLHKKNHMVEKTYECKECGKSFGDLVSRRKHMRIHIVKKPVECRQCGK 425

  Fly   451 KFKVEWAYKTHMQRHEQERAHFRCELCPKIF----RLRAELKHHMAQRHDEHGFIYECKRCQRTF 511
            .|:.:...||||..|..|:. :.|:||.|.|    .|.|..|.|..:|.      |||..|.:.|
Human   426 TFRNQSILKTHMNSHTGEKP-YGCDLCGKAFSASSNLTAHRKIHTQERR------YECAACGKVF 483

  Fly   512 LTQQRLQRHQAVGCQRHKEDSVRIKEEQSRFKQESRSKDDRHHGNNSSKRRPGE 565
            ......:||.:|...:.:   |..::....|:.:|..|.   |..:.:..:|.|
Human   484 GDYLSRRRHMSVHLVKKR---VECRQCGKAFRNQSTLKT---HMRSHTGEKPYE 531

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12391	NP_610639.1	zf-AD	240..313	CDD:285071
		zf-C2H2	416..438	CDD:278523	7/21 (33%)
		C2H2 Zn finger	418..438	CDD:275368	7/19 (37%)
		zf-C2H2	443..465	CDD:278523	10/31 (32%)
		C2H2 Zn finger	445..465	CDD:275368	9/19 (47%)
		C2H2 Zn finger	474..491	CDD:275368	8/20 (40%)
		C2H2 Zn finger	504..521	CDD:275368	4/16 (25%)
ZNF317	NP_065984.3	KRAB	57..109	CDD:214630
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	109..128
		COG5048	222..580	CDD:227381	47/184 (26%)
		C2H2 Zn finger	224..244	CDD:275368
		C2H2 Zn finger	252..272	CDD:275368
		C2H2 Zn finger	280..300	CDD:275368
		C2H2 Zn finger	308..328	CDD:275368
		C2H2 Zn finger	336..356	CDD:275368
		C2H2 Zn finger	364..384	CDD:275368	7/19 (37%)
		C2H2 Zn finger	392..412	CDD:275368	2/19 (11%)
		C2H2 Zn finger	420..440	CDD:275368	9/19 (47%)
		C2H2 Zn finger	448..468	CDD:275368	8/19 (42%)
		C2H2 Zn finger	476..496	CDD:275368	5/19 (26%)
		C2H2 Zn finger	504..524	CDD:275368	4/22 (18%)
		C2H2 Zn finger	532..552	CDD:275368	47/184 (26%)
		C2H2 Zn finger	560..580	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000