Sequence 1: | NP_610639.1 | Gene: | CG12391 / 36170 | FlyBaseID: | FBgn0033581 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064353.2 | Gene: | Plag1 / 56711 | MGIID: | 1891916 | Length: | 499 | Species: | Mus musculus |
Alignment Length: | 241 | Identity: | 54/241 - (22%) |
---|---|---|---|
Similarity: | 85/241 - (35%) | Gaps: | 64/241 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 366 SDDSEKEKKKPGPRGRPRKKPLKRGTDS--DGEPSSAQKKKYQPSSTASVGPFECPNCDLT--FS 426
Fly 427 RKQSYVLHRKTHE-RIEHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHH 490
Fly 491 MA---------------QRHDEHGFI-------------------YECKRCQRTFLTQQRLQRHQ 521
Fly 522 AVG-------CQ------------------RHKEDSVRIKEEQSRF 542 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167847319 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |