DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and plag1

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001034903.1 Gene:plag1 / 561450 ZFINID:ZDB-GENE-060302-2 Length:393 Species:Danio rerio


Alignment Length:162 Identity:43/162 - (26%)
Similarity:70/162 - (43%) Gaps:18/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 FECPNCDLTFSRKQSYVLHRKTH--ERIEHACPI-CGKKFKVEWAYKTHMQRHEQERAHFRCELC 477
            |.|..|:..|:..:...:|..:|  ||..|.... |.|.|..::....||..|..|:.| :|..|
Zfish    31 FSCQLCEKAFNSLEKLKVHSYSHTGERPYHCTHTDCTKAFVSKYKLLRHMATHSPEKTH-KCSYC 94

  Fly   478 PKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQA--------VGCQ--RHKEDS 532
            .|:|..:..||:|: ..||.:...:.|..|.:::.|:...:||||        :.||  .....|
Zfish    95 EKMFHRKDHLKNHL-HTHDPNKEAFSCTECDKSYNTKLGFRRHQALHAAQRGDLTCQVCLQSYPS 158

  Fly   533 VRIKEEQSR---FKQESRSKDDRHHGNNSSKR 561
            ..:..|..|   .|..:.:|:.||..:...:|
Zfish   159 TPLLLEHLRGHAGKSATATKEKRHQCDQCERR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 5/21 (24%)
C2H2 Zn finger 418..438 CDD:275368 4/19 (21%)
zf-C2H2 443..465 CDD:278523 6/22 (27%)
C2H2 Zn finger 445..465 CDD:275368 5/20 (25%)
C2H2 Zn finger 474..491 CDD:275368 6/16 (38%)
C2H2 Zn finger 504..521 CDD:275368 4/16 (25%)
plag1NP_001034903.1 COG5048 29..>99 CDD:227381 20/68 (29%)
C2H2 Zn finger 33..53 CDD:275368 4/19 (21%)
C2H2 Zn finger 61..83 CDD:275368 5/21 (24%)
zf-H2C2_2 76..100 CDD:290200 9/24 (38%)
C2H2 Zn finger 91..111 CDD:275368 7/20 (35%)
C2H2 Zn finger 120..140 CDD:275368 7/19 (37%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
C2H2 Zn finger 184..204 CDD:275368 1/7 (14%)
C2H2 Zn finger 212..230 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.