DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and znf367

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001017726.2 Gene:znf367 / 550421 ZFINID:ZDB-GENE-050417-231 Length:316 Species:Danio rerio


Alignment Length:239 Identity:62/239 - (25%)
Similarity:84/239 - (35%) Gaps:82/239 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 SDVAGTTSADSDSADSDD-SEKEKKKPG-PRGRPRKKPLKRGTDSDGEPSSAQKKKYQPSSTASV 413
            |..|..|...|..|::|. |..|..|.| .|||||...: |...::||.|:::            
Zfish    69 SGAASPTRTSSSPAEADPLSCPEHLKDGIRRGRPRADTV-RELINEGENSTSR------------ 120

  Fly   414 GPFECPNCDLTFSRKQSYVLHRKTH--ERIEHAC--PICGKKFKVEWAYKTHMQRHEQERAHFRC 474
              ..|..|:..|.|::|...|::||  || .:.|  |.|||.|......|||.:.|..|:.    
Zfish   121 --IRCNICNRVFPREKSLQAHKRTHTGER-PYLCDYPDCGKAFVQSGQLKTHQRLHTGEKP---- 178

  Fly   475 ELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQAVGCQRHKEDSVRIKEEQ 539
                                     |:...|.|...|   ....||    |.:|         ..
Zfish   179 -------------------------FVCSEKACGSRF---THANRH----CAKH---------PY 202

  Fly   540 SRFKQESRSKDDRHHGNNSSKRRPG--EGRDLFKAVAPPTTTYW 581
            :|.|:|..:..            ||  :|.| .||||...|.||
Zfish   203 ARLKREEPTGG------------PGKSQGAD-NKAVAEWLTKYW 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 6/21 (29%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-C2H2 443..465 CDD:278523 9/23 (39%)
C2H2 Zn finger 445..465 CDD:275368 9/21 (43%)
C2H2 Zn finger 474..491 CDD:275368 0/16 (0%)
C2H2 Zn finger 504..521 CDD:275368 4/16 (25%)
znf367NP_001017726.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..97 9/27 (33%)
COG5048 115..>182 CDD:227381 24/110 (22%)
C2H2 Zn finger 123..143 CDD:275368 6/19 (32%)
C2H2 Zn finger 151..173 CDD:275368 9/21 (43%)
C2H2 Zn finger 181..200 CDD:275368 6/25 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..294 62/239 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.